SecReT6
Protein ID: 218676751
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0990
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1093545..1094858 [+]
Producthypothetical protein
NoteTssA
UniProt IDB7VTS7
KEGG IDvsp:VS_II0990
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-17, Aligned region: 46..104
Protein Sequence: 437 a.a.     [Download]
>gi|218676751|ref|YP_002395570.1| hypothetical protein VS_II0990 [Vibrio splendidus LGP32]
MLSSDFTRRPIDEKKPYGTNPNGLDEFTEIKRQINNINKVTGRVSWKKIQTLSKEILSKNSKDFRCSCYF
TVAATHNEGLKGLVEGLNSILDLCVIYWFTAYPEVTKSNARIGAIDWMVEHTDKRIKSIKTSSDDILLIE
TCHRLCLRIEEELRLHYGIKAPSLGGIRRTLKHWVDEHKENEAKLFEAENTKKLRVSEEHKKAIPVVQPS
TIKIDVSNNKPKNAAEVDGKSTSSYLVIYLLVGFLILALSSHFIYKQYQRKELARQIVTSDIPQLNEIVH
SLKYEYASISDDVRPSVVNQLDELMKDWGTDPIKVYEIDTLNQLTIDLTKLYPDSSSVLRLRNEFTNEQQ
KLNADYIKLHRRFSNARTVFANAIRGSESQKTAQAYEYSNSLFPLIGRIEYAEKEKQQKELQKSLQILNV
YLHKIKNLESELKAIKP
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|294510242|ref|NC_011744.2|:1093545-1094858 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGCTCTCGTCAGATTTTACAAGACGCCCCATTGATGAAAAAAAACCCTACGGAACCAATCCTAACGGGT
TAGATGAATTCACAGAGATAAAGCGCCAAATTAATAACATAAACAAGGTCACAGGCAGAGTTTCTTGGAA
AAAAATTCAGACTTTGTCGAAAGAAATACTGTCCAAAAACAGTAAAGATTTCCGTTGTAGCTGTTATTTT
ACTGTTGCAGCTACGCACAACGAAGGCTTAAAAGGTTTAGTTGAAGGGCTTAACTCTATCTTAGATTTGT
GTGTCATTTATTGGTTCACCGCATATCCAGAGGTGACAAAATCAAATGCAAGGATCGGAGCGATTGATTG
GATGGTCGAACACACAGATAAACGAATTAAGTCCATAAAAACAAGTTCCGACGACATTCTATTGATCGAA
ACATGCCACCGCTTATGTTTGAGAATAGAAGAAGAGCTCAGACTACATTACGGTATAAAAGCACCTTCAC
TGGGGGGAATTCGTCGAACCTTAAAGCACTGGGTTGATGAGCATAAAGAGAACGAAGCAAAACTCTTTGA
AGCAGAAAACACAAAAAAACTCCGCGTTTCGGAAGAACATAAAAAGGCAATACCAGTAGTTCAGCCATCA
ACCATTAAAATCGATGTGTCTAACAATAAACCTAAGAATGCAGCTGAAGTCGATGGAAAATCGACCTCGA
GTTATTTAGTCATCTATCTTCTCGTTGGGTTTCTAATTTTGGCTTTATCCTCTCATTTCATTTATAAACA
ATATCAACGAAAAGAGTTGGCTAGACAAATCGTTACGTCTGATATCCCACAACTGAATGAAATAGTACAT
TCACTAAAGTATGAATATGCTTCGATTTCTGATGATGTAAGACCTAGTGTCGTCAATCAATTAGATGAAT
TAATGAAAGATTGGGGTACCGATCCAATTAAAGTGTACGAGATCGATACTCTAAATCAATTGACTATTGA
TTTAACTAAGCTTTACCCAGACTCATCATCCGTCTTACGTTTACGTAACGAATTCACTAATGAGCAACAA
AAGTTAAACGCAGATTACATAAAACTTCATCGACGCTTCTCAAACGCGAGAACTGTGTTTGCAAATGCAA
TTAGAGGAAGTGAAAGTCAGAAAACAGCACAAGCTTACGAATACAGCAACTCCCTTTTCCCGTTGATTGG
CCGTATTGAATATGCAGAAAAAGAAAAACAACAAAAAGAGCTGCAGAAATCTCTTCAAATACTCAACGTC
TATTTACACAAAATTAAAAACTTGGAGTCTGAGCTTAAAGCTATTAAACCGTAA

Protein ID: 218676759
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0998
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1104099..1105676 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7VTT5
KEGG IDvsp:VS_II0998
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 48..108
Protein Sequence: 525 a.a.     [Download]
>gi|218676759|ref|YP_002395578.1| hypothetical protein VS_II0998 [Vibrio splendidus LGP32]
MSLIDTETLLAPIPGASPTGEDARYEFCYEMMETEVKKFGSLFGETVDWHIVKVHSIEVLSQHSKDLKAL
CYLIRALAEENGVAGLDEGLSLLNESISHFGGELYPKRKRGRDGAVEWLNHQIKLVSTKLSTQSLSWEAL
SRCVTLVESIQRQFDQIFQDSDADFFEIKTQLNQLMQNAASSEEVLGQDRAVVTGLLTEASEKSEKVKDV
DVQPPLDSSLTQALSNKARISPSELNFVDVETDFSSPTASKRTLKKVAEMMMHSNPTEPLGYRIYRHLTW
FDVDGLPDHQENVTQLSLAVSLDQQVEYRDKAHQESDIDTIKRLERTLTDAPFWLTGHYFVYSMLSNLGY
DEAATAVKQETRRFIDSFNGIESLSFKNSIPFADEATIAWLSTGNGSSSDNSSIVQSIVVSEDDLSEMED
IALEDLGMYVAELSEKLELDNSGRGQFMLHLKLVKAYQNVGLYPLCLPYLEKSWEVSKELNLSIWEPHLF
FTLEHLIQKTLRELYRNKDFLPKIYSEWGTIYDQQ
 
Nucleotide Sequence: 1578 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1105676-1104099 Vibrio splendidus LGP32 chromosome 2, complete sequence
TTGAGTTTGATCGATACAGAAACGTTATTAGCACCAATACCAGGAGCCTCTCCAACGGGTGAGGACGCTA
GGTATGAGTTTTGCTACGAAATGATGGAAACTGAAGTTAAAAAATTTGGTTCATTGTTTGGTGAGACTGT
TGACTGGCATATAGTAAAGGTCCATTCAATTGAGGTACTAAGTCAACATAGTAAGGATCTTAAAGCGCTT
TGCTATTTGATTCGAGCTTTGGCTGAAGAGAACGGAGTCGCTGGGCTAGACGAAGGTTTATCTTTGCTTA
ACGAATCAATAAGCCATTTTGGGGGCGAGTTATATCCAAAACGTAAGCGAGGTAGAGATGGTGCCGTTGA
ATGGTTGAACCATCAAATTAAACTTGTTTCGACTAAATTGTCTACCCAATCTTTGAGTTGGGAAGCACTT
TCACGTTGTGTGACATTAGTCGAAAGTATTCAGCGCCAATTTGACCAAATATTTCAAGATTCTGATGCGG
ACTTTTTTGAAATAAAAACTCAGCTAAATCAGTTGATGCAGAACGCAGCTTCAAGCGAAGAGGTATTAGG
ACAAGACAGGGCGGTCGTTACAGGTCTGTTGACCGAAGCGAGTGAAAAGTCCGAGAAAGTGAAAGATGTC
GACGTTCAACCACCTTTAGATTCTTCTTTGACTCAAGCTTTGTCAAATAAAGCACGGATCTCGCCCAGTG
AACTTAACTTCGTTGACGTTGAAACGGATTTTTCGTCTCCGACAGCATCAAAGCGTACGTTAAAAAAAGT
TGCAGAAATGATGATGCATTCTAATCCGACAGAACCATTAGGATATCGGATTTATCGTCATCTCACGTGG
TTCGACGTTGACGGTCTACCAGACCACCAAGAAAACGTTACTCAGCTGAGTTTAGCGGTTTCATTAGATC
AGCAAGTTGAGTATCGAGACAAAGCACATCAAGAAAGTGATATTGACACAATTAAGCGTCTCGAACGAAC
TCTGACCGATGCGCCCTTTTGGCTGACTGGACATTATTTTGTTTATTCAATGTTGAGTAATCTTGGGTAT
GACGAAGCTGCAACGGCCGTTAAACAAGAAACAAGGAGGTTTATCGATTCTTTTAATGGAATTGAAAGCC
TATCTTTTAAAAATTCTATTCCATTTGCAGATGAAGCAACCATTGCTTGGTTATCTACAGGTAATGGTTC
GTCTTCGGATAACTCTTCAATTGTTCAAAGTATTGTTGTTTCTGAAGATGATTTATCAGAGATGGAGGAT
ATTGCCCTAGAAGATTTGGGTATGTATGTCGCTGAACTGTCTGAAAAACTCGAGTTGGATAACTCCGGTC
GTGGGCAGTTTATGTTGCATTTGAAGTTAGTAAAAGCCTACCAAAATGTTGGTTTGTATCCGTTGTGCTT
GCCTTACTTGGAAAAAAGTTGGGAAGTCAGCAAAGAATTAAATCTATCAATTTGGGAACCTCATTTGTTT
TTCACCTTAGAGCATTTAATTCAAAAAACTCTTAGGGAACTGTATCGAAATAAAGATTTTCTACCAAAGA
TATATAGCGAATGGGGAACAATTTATGACCAGCAATAA