SecReT6
Protein ID: 218676754
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0993
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1098871..1099896 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7VTT0
KEGG IDvsp:VS_II0993
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-84, Aligned region: 19..327
Protein Sequence: 341 a.a.     [Download]
>gi|218676754|ref|YP_002395573.1| hypothetical protein VS_II0993 [Vibrio splendidus LGP32]
MGELNWATNDLMIDVLAEKTNEFSFFQAVLLLEKHYQLLPDGEFVAVGENKYFRQERVAFSVSPNLCFPK
SDMEFICHMERSGKQYSRIETNFLGLHGSSSPLPANYTEKLVGRDIDDNPVKDFFDFFHNRYTSLIYRVW
KKYRYHVQYQSGAADKFSGRMLHLAGLSNVIQESEAIGLDRAKILSYVNQLSTRTRSPKLISGIVAHYFS
LPSVRIEEWVFRRVNIAECQRNQLNRTNCTLGSNLHLGKSIPDLNGKFNLCIDNVDFDTYRKFSYGGELH
TTLVGLMRFILRDPMSWDLRLTVDIGSIPKNQLGQGASLGQTLWLGQASEKDAKIRVIGGV
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1099896-1098871 Vibrio splendidus LGP32 chromosome 2, complete sequence
TTGGGCGAGCTTAACTGGGCAACAAACGATCTTATGATTGATGTATTAGCAGAGAAGACCAATGAATTTA
GCTTCTTTCAAGCTGTTCTGTTATTGGAGAAGCATTATCAACTTTTGCCGGACGGTGAATTTGTAGCTGT
TGGTGAAAATAAGTACTTTCGTCAAGAGAGGGTTGCGTTCAGCGTTTCACCAAATCTATGTTTCCCTAAA
AGTGACATGGAATTTATCTGTCACATGGAAAGATCGGGTAAGCAATATTCTAGAATCGAAACTAATTTTT
TGGGCTTGCATGGCTCTAGTTCTCCTTTACCAGCTAATTACACCGAAAAGTTAGTTGGTAGAGATATTGA
TGATAATCCGGTCAAAGATTTTTTTGATTTCTTCCATAATCGATATACCAGCTTAATTTATCGTGTTTGG
AAAAAGTATCGTTATCATGTTCAGTATCAAAGTGGTGCAGCGGACAAGTTCTCTGGACGAATGTTACACC
TAGCTGGCTTGTCTAATGTTATTCAAGAGTCAGAAGCGATAGGACTCGATCGTGCAAAGATTTTGTCTTA
CGTTAATCAACTTTCTACTAGAACACGATCGCCTAAACTAATTTCCGGTATTGTGGCGCATTACTTTTCA
TTACCAAGTGTACGAATTGAAGAGTGGGTATTCCGGAGAGTGAATATTGCAGAATGTCAAAGAAATCAAT
TGAATAGAACTAATTGTACTTTGGGTTCAAACCTACATTTAGGCAAGAGTATCCCAGACCTAAACGGGAA
ATTTAACCTCTGTATCGACAATGTTGACTTTGATACGTACCGTAAGTTTTCCTATGGTGGAGAGCTTCAT
ACCACCCTAGTTGGTTTGATGCGCTTCATTCTTCGCGACCCAATGTCTTGGGATCTAAGGCTTACTGTTG
ATATAGGTTCGATCCCCAAGAATCAGCTTGGCCAAGGAGCTAGCCTTGGCCAGACGTTATGGTTAGGTCA
AGCGAGTGAAAAAGATGCCAAAATTAGGGTTATTGGAGGCGTATGA