SecReT6
Protein ID: 218676755
SecReT6 ID318
T6SS typei1
Gene symbolvasA
Locus tagVS_II0994
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1099860..1101710 [-]
ProductType VI secretion system; VasA
NoteTssF
UniProt IDB7VTT1
KEGG IDvsp:VS_II0994
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.00E-190, Aligned region: 39..616
Protein Sequence: 616 a.a.     [Download]
>gi|218676755|ref|YP_002395574.1| Type VI secretion system; VasA [Vibrio splendidus LGP32]
MAFAEKSYITVGKFRCPLTSIWELTANLTFSRCPLSNSKYFQDELTYLRESGSEFAKYNPKLTNFLSEGT
FDPDVERLLEGFAFLTGRIREKIDDELPELTQSLMTLLWPHYMRSIPSLCISELTPHLGSVTEKTVVRRG
AEMASEQVEGTQCLFRTCYDVELFPLQITSIEQSNSRTSSSVDVTLATEHGLELSRIGLDKLRFHLHGEI
HITRILFLWIFRYLDYVELDVGGAYKRKLGPEFVKPVGYQDDEAILPYSENSFAGYRLLQEYFSLPEKFM
FFDVTGLEWLKGVPQKSTVNLKFHFKRALPAEVVLKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVR
PQSSNQDHYEVYSIDQVESWSKNERRRKPLIEFESFEHQINQRDKRDFYKSKVSERVSGRGLERFISFHT
HNGDIADLGSETVLMKLQCSNSDLSERLSVGDVIYTTHKSPTYATFSNITKPTQSVSPQVNGELQWQLIA
NMSLNYLSLSNIDVLKVLLSTYDFHSRVDRQAHRASLHRLDGIISSEMKPIDRVFRGVSVRGNQLKLMMN
SSFFVNEGDMFLMANVLNEFIRLYSSVNSFTELEVYDEQRGESYHWASLTGQQTIL
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1101710-1099860 Vibrio splendidus LGP32 chromosome 2, complete sequence
TTGGCATTTGCGGAGAAGTCTTACATAACGGTGGGAAAGTTCCGATGTCCATTGACGTCTATATGGGAAC
TGACGGCCAATTTAACGTTTAGTAGGTGTCCCTTGAGTAACAGTAAATACTTTCAAGATGAACTCACATA
TCTACGAGAATCCGGCAGTGAGTTTGCCAAATACAATCCCAAACTGACCAACTTTCTGTCCGAAGGGACA
TTCGATCCTGATGTCGAGCGTCTTCTTGAAGGTTTTGCGTTCCTTACTGGCCGCATCAGAGAAAAAATCG
ATGACGAACTTCCAGAGTTGACCCAATCATTGATGACGCTATTGTGGCCACATTATATGCGTTCTATTCC
GTCGTTGTGCATTAGTGAGTTAACGCCACATTTAGGAAGTGTTACGGAAAAAACGGTAGTGAGGCGCGGG
GCTGAGATGGCTAGCGAACAAGTTGAAGGAACGCAGTGCTTATTTAGAACCTGTTATGACGTAGAGCTCT
TCCCGCTTCAAATAACAAGTATCGAACAAAGTAACAGCAGAACAAGCTCTTCGGTTGATGTAACACTGGC
TACTGAACATGGCTTAGAACTATCACGTATTGGATTAGATAAACTGAGGTTTCATTTACATGGTGAGATT
CATATAACTAGAATTCTATTTTTGTGGATATTTAGATACTTAGATTATGTTGAGCTGGATGTTGGCGGTG
CCTATAAACGTAAACTAGGACCTGAGTTTGTCAAGCCGGTTGGTTACCAAGACGATGAGGCAATATTGCC
TTATAGCGAAAACTCATTTGCCGGTTATCGATTGTTACAAGAATACTTTTCGTTACCTGAGAAATTTATG
TTCTTTGATGTCACCGGCCTTGAGTGGTTAAAAGGGGTCCCACAAAAGAGTACTGTAAATCTGAAGTTTC
ATTTTAAGAGAGCATTACCAGCTGAAGTCGTCCTGAAAGATAAGCACTTAAGGCTACATTGCACTCCAGC
CGTCAACCTGTTCGAAAAAGATGGGGACCCGATCAGGCTCGAGCACCGTCGCAATGAATACAAAGTAAGG
CCACAAAGTAGTAATCAAGATCATTACGAAGTTTACTCAATAGACCAAGTAGAAAGTTGGAGTAAAAATG
AAAGGCGCCGAAAACCTCTTATCGAATTTGAGTCTTTTGAGCATCAAATCAACCAGAGAGATAAGCGTGA
TTTTTACAAGTCTAAAGTATCTGAGCGAGTGAGTGGGAGAGGGCTTGAACGTTTTATCTCTTTCCATACC
CACAATGGTGATATCGCAGATCTAGGTTCTGAAACAGTGCTGATGAAGTTACAGTGTAGCAATTCGGATC
TTTCTGAAAGATTGTCTGTTGGTGATGTCATATATACAACACATAAATCACCAACTTACGCTACTTTTAG
CAACATTACTAAACCTACACAATCTGTTAGCCCTCAAGTCAACGGAGAGCTCCAATGGCAACTAATTGCA
AATATGTCTCTCAATTATTTATCGCTCTCTAATATCGATGTACTTAAAGTTTTACTCTCGACATACGACT
TTCACTCTAGAGTAGATAGGCAGGCACACAGAGCTTCATTACATAGGCTTGATGGTATTATCTCATCAGA
AATGAAACCTATCGATAGAGTGTTTAGAGGGGTATCAGTACGAGGTAATCAACTAAAGTTAATGATGAAC
TCTAGCTTTTTTGTAAATGAAGGCGACATGTTTTTGATGGCGAATGTACTGAACGAGTTCATACGATTAT
ATTCAAGCGTTAACTCATTTACAGAGTTAGAAGTTTACGATGAACAACGTGGAGAAAGCTATCATTGGGC
GAGCTTAACTGGGCAACAAACGATCTTATGA