SecReT6
Protein ID: 218676757
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0996
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1102090..1103565 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7VTT3
KEGG IDvsp:VS_II0996
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-186, Aligned region: 66..490
Protein Sequence: 491 a.a.     [Download]
>gi|218676757|ref|YP_002395576.1| hypothetical protein VS_II0996 [Vibrio splendidus LGP32]
MSAEVQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVEAFIGELLSSSTVEKVDQSLVDLMIS
EIDQKLSKQVDAILHNEEIQAIESTWRGLKYLVDHTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLY
KQIYTREYGQFGGKPVGAVICDYQLSASSPDIKLMEYMGNVGAMSHAPFITSASSQFFGLDSYEELPNLK
DLKSVFEGPQYTKWRGFREHEDARYVGLCTSRFMLRTPYSVEDNPIKAFDYDEMVTDSHDNYLWGNSAYA
MASKISESFAKYRWCPNIIGPQSGGAVNDLPVYNFEAMGQIETKIPTEILVSDRREYELAEEGFMALTMR
KGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERSDLE
VELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVEGDPGWYKVSMSVRPHFKYMGASFDLSLVGKLD
Q
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1103565-1102090 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGTCGGCAGAAGTACAAGCACCAGAACAAGAAGCAGCTCTAGTTGAATCAGGCTCACTTCTGGATAGCA
TTCTAAATGAGACTCGCCTCAAGCCTAGCGACGAAGGTTTTGACGTTGCAAAGCGTGGCGTTGAAGCATT
TATTGGTGAGTTGTTAAGCAGCTCAACAGTAGAAAAAGTAGACCAATCGCTGGTTGATTTGATGATCTCT
GAGATTGACCAGAAATTATCTAAGCAGGTTGATGCAATTCTACACAATGAAGAAATTCAAGCTATTGAAT
CAACATGGCGCGGGCTCAAATATCTTGTTGATCACACGGACTTCCGTGAGAACATTCAAATCGAACTTAT
TTCGGCTAAGAAAGACGAAGTTCTGGACGATTTTGAAGATGCCCCTGAAGTAGTTAAATCCGGTTTATAC
AAGCAGATCTATACTCGTGAGTATGGTCAATTTGGCGGTAAGCCTGTAGGCGCTGTTATTTGTGACTACC
AATTGTCTGCTTCTTCACCTGATATTAAGTTGATGGAATATATGGGTAATGTAGGAGCTATGTCTCATGC
ACCATTTATTACTTCGGCTTCTTCTCAATTCTTTGGTTTGGATTCTTATGAAGAATTACCAAATTTAAAA
GATTTGAAATCGGTATTTGAAGGCCCTCAATATACTAAGTGGCGTGGATTCCGCGAACACGAAGACGCAC
GTTATGTAGGCCTGTGTACATCACGCTTTATGCTTCGTACTCCATATTCAGTTGAAGATAACCCAATTAA
GGCGTTTGATTACGATGAAATGGTTACGGATAGCCACGATAACTACCTTTGGGGTAACTCAGCTTACGCG
ATGGCTTCAAAGATCAGTGAGTCGTTTGCAAAATACCGTTGGTGTCCAAATATTATTGGACCTCAAAGCG
GCGGTGCGGTTAACGATCTTCCGGTATACAACTTTGAAGCGATGGGCCAGATCGAAACTAAGATCCCAAC
TGAAATATTGGTTTCTGACCGTCGTGAGTACGAACTTGCAGAAGAAGGCTTTATGGCGTTAACAATGCGC
AAAGGTTCTGACAATGCAGCGTTTTTCTCGGCAAACTCAGTACAGAAGCCAAAAGTGTTTGCGAATACGC
CTGAAGGTAAGCAAGCTGAGATGAATTACAAGTTGGGTACTCAGTTACCTTACATGTTCATTATCAACCG
CTTAGCCCATTACATCAAGGTACTTCAGCGTGAGCAAATAGGGTCTTGGAAAGAGCGTTCAGACCTTGAA
GTCGAGCTAAATAAATGGATCCGTCAATACGTATCTGATCAAGAAAACCCGCCAGCAGAAGTTCGTGGTC
GTCGACCATTGCGAGCGGCTAAAGTTGAAGTGTCTGATGTTGAGGGTGACCCAGGTTGGTACAAAGTATC
AATGTCTGTTCGCCCGCATTTCAAGTACATGGGTGCAAGCTTTGACTTATCTTTGGTTGGTAAACTAGAC
CAATAA