SecReT6
Protein ID: 218676758
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0997
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1103574..1104080 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7VTT4
KEGG IDvsp:VS_II0997
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.70E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|218676758|ref|YP_002395577.1| hypothetical protein VS_II0997 [Vibrio splendidus LGP32]
MSRDGSVAPKERINIRYVPATGDASEDVELPLSMMVVGDFTARADETPIEERNPINIDKDNFNEVLEGYA
PNIKANVDNRLSDEEGAQIGVDITFKNMKDFTPESIAKKVPELNGLLELREALVALKGPLGNVPAFRKKI
AAVLQDEEARKKLLDELSIGADQGEKAE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1104080-1103574 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGTCACGTGATGGCTCGGTGGCTCCGAAAGAGCGAATTAATATACGTTATGTTCCAGCGACAGGCGATG
CGTCTGAAGATGTTGAACTGCCTCTAAGTATGATGGTCGTCGGTGATTTTACTGCCCGTGCAGATGAAAC
ACCGATCGAAGAGCGTAATCCTATTAATATCGATAAAGACAACTTTAACGAAGTATTAGAAGGCTATGCG
CCGAATATCAAAGCAAACGTTGACAATCGACTTTCTGACGAAGAAGGCGCGCAAATTGGCGTTGATATTA
CATTTAAAAATATGAAGGACTTTACTCCTGAGTCTATTGCGAAGAAAGTTCCAGAATTAAATGGCTTATT
AGAGCTTCGTGAAGCCTTGGTTGCATTAAAAGGCCCTCTAGGAAATGTACCTGCTTTCCGTAAGAAGATA
GCAGCTGTTCTTCAAGATGAAGAAGCAAGAAAGAAACTTTTGGATGAACTTAGCATTGGTGCAGACCAAG
GCGAAAAAGCAGAGTAG