SecReT6
Protein ID: 218676765
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II1004
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1111926..1114004 [-]
ProductVgr protein
NoteTssI
UniProt IDB7VTU1
KEGG IDvsp:VS_II1004
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-67, Aligned region: 27..331
Phage_base_V [PF04717], Evalue: 1.60E-23, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 533..543
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 568..586
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 616..636
Gp5_C [PF06715], Evalue: 0.0021, Aligned region: 675..690
Protein Sequence: 692 a.a.     [Download]
>gi|218676765|ref|YP_002395584.1| Vgr protein [Vibrio splendidus LGP32]
MVNDVEFKFELQGSEHDFRVESFQVIEELSKPFQISLSLLSLDPDISFDALIRKPGSLTLYGQGVSSARC
FHGVVNEVRYLGSGRRFSRYQLTLVPQAWFLSQRQDCRIFQQKSASAIISEVLDDASVTDYRLELSGVYP
SKEYVLQYRETDLEFVQRILAEHGMWYYFEHTEANHTMVIVDSNDAIAELLNTPLNGSYLGPIVYHADGG
GVADREHISDLELVNRVKTGHVTYTDYNYEFPKIPQEMSSSGELDLDLKLFDFPGRYVDPAMGQVRSNEW
MSEHVVDNQQVEASSNVMRLASGYSFSVSEHPRSAINRDYLMLSVMHSGHDPQVHEDETNGLPTTYHNQF
ACIPRHVEFKAPKLEAPLVEGTQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGESDEHSSCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHYPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNDVHGDHKETIDGHKTTQINSTFTETVEQ
DVSVTYNANETQYVKNNSDLEIGDNQITKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSV
KGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGGDKVVVKGGNVAVN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1114004-1111926 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGGTGAATGACGTAGAATTTAAGTTTGAACTGCAAGGCTCTGAGCATGATTTCCGTGTTGAAAGCTTTC
AGGTAATCGAAGAGCTTTCCAAGCCTTTTCAAATCAGCCTATCATTACTTTCACTTGATCCTGATATCTC
ATTTGACGCACTCATCCGTAAACCAGGTAGTTTGACTCTATACGGTCAAGGCGTCAGTTCTGCGAGATGT
TTTCACGGCGTGGTAAATGAGGTGCGTTACCTTGGATCGGGCAGGAGATTCTCTCGTTACCAATTGACTC
TAGTTCCACAAGCTTGGTTTTTGAGCCAAAGACAAGACTGCCGTATTTTTCAACAGAAATCAGCGTCGGC
AATCATTTCTGAAGTTTTAGATGATGCGTCAGTAACTGATTATCGATTAGAGCTGTCAGGCGTATATCCT
TCAAAAGAATACGTGCTCCAATATCGAGAGACAGACCTTGAGTTTGTTCAACGAATTCTGGCAGAACACG
GAATGTGGTACTACTTCGAGCATACAGAAGCTAACCACACGATGGTGATTGTCGATAGCAATGACGCAAT
AGCTGAGTTATTGAACACGCCACTGAACGGGTCTTATTTGGGGCCAATTGTTTACCATGCTGATGGTGGT
GGTGTTGCAGACCGCGAGCATATCTCAGACCTTGAACTCGTGAATAGAGTGAAAACCGGCCACGTTACTT
ACACTGATTATAACTACGAGTTTCCGAAAATTCCTCAGGAAATGAGCAGCTCTGGTGAACTTGATTTAGA
CCTGAAATTGTTCGATTTCCCAGGGCGTTACGTGGACCCAGCAATGGGGCAAGTAAGATCAAATGAATGG
ATGTCGGAGCATGTTGTTGACAATCAACAAGTAGAAGCAAGCAGCAATGTCATGAGATTGGCTTCTGGAT
ACAGTTTTAGTGTCAGCGAACATCCACGCTCAGCAATCAATCGTGATTACCTCATGTTATCGGTAATGCA
TAGTGGCCACGATCCTCAGGTTCATGAAGACGAAACTAATGGCTTGCCGACCACATATCACAACCAGTTT
GCGTGCATTCCTAGACATGTTGAATTTAAGGCTCCAAAACTTGAAGCTCCTTTAGTTGAAGGTACACAAA
CAGCGGTTGTTGTTGGCCCTGCAGGCGAAGAGATCTATACAGATAAGCTTGGGCGAATCAAAGTCCAGTT
CCATTGGGACCGTTATGGAGAGAGCGATGAGCATTCAAGTTGCTGGATTCGTGTTAGCCAATCAATGGCA
GCACCAACTTGGGGAGCAGTATACTTACCTCGTATCGGCCATGAGGTGGTGGTTACTTTCCTAGAAGGCG
ATCCAGACAGGCCTTTAGTGACAGGTGCTGTTTATAACGGGCTTCATTATCCTCCTTATTCGTTACCAGA
GAATAAAACACGTACGACATTCCGAACTCAAACGCATAAAGGGACTGGCTATAACGAGTTGAGCTTTGAA
GATGAAGCCAATCAAGAAGAAGTCTACATTCATGCACAAAAGGACATGTCGACCAAGGTTTTAAATAACC
GCTATCGAGACATAGGCCAAGATGAATTCTTGAAAGTGGCGCGCCATCAGACGAACGATGTTCATGGTGA
TCATAAAGAGACAATCGATGGCCATAAGACTACCCAAATTAACAGTACGTTTACTGAAACTGTCGAGCAA
GACGTATCGGTTACTTACAACGCTAATGAAACTCAATATGTAAAGAACAACTCTGATCTAGAAATTGGAG
ATAATCAAATTACCAAGATTGGTAAGAATGATGACTTGGATGTGGGTGAAAACAGCAATTTAACGGTAGG
CGCATCAAAAAGCTCTGATATTGGTGCCGATGATAACCAAACGGTTGGTGGCAACTTGACTGTGTCTGTG
AAAGGGAACACGTCATATAAAGCCGATGGTGCGACCCAGATCATAAGCGGTGACAAGATTGTACTGAAAA
CGGGTGGTTCGTCATTAGTGATGAATAGCGACGGTTCTATTAAGCTGTCAGGTTCTTCAATAACCATTGA
AGGAGGTGACAAAGTTGTAGTCAAAGGTGGCAACGTAGCGGTCAATTAA