SecReT6
Protein ID: 218676767
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II1006
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1115052..1117745 [+]
ProductChaperone ClpB
NoteTssH
UniProt IDB7VTU3
KEGG IDvsp:VS_II1006
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 219..263
AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 440..468
AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 631..795
AAA [PF00004], Evalue: 2.20E-22, Aligned region: 220..348
AAA [PF00004], Evalue: 2.20E-22, Aligned region: 636..761
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 195..238
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 428..493
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 610..658
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 700..729
AAA_16 [PF13191], Evalue: 1.40E-14, Aligned region: 857..871
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 220..237
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 293..348
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 635..770
ClpB_D2-small [PF10431], Evalue: 8.40E-13, Aligned region: 802..877
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 633..740
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 215..234
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 635..755
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 220..283
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 387..405
AAA_17 [PF13207], Evalue: 4.80E-06, Aligned region: 634..658
NACHT [PF05729], Evalue: 4.70E-05, Aligned region: 220..246
NACHT [PF05729], Evalue: 4.70E-05, Aligned region: 635..660
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 218..238
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 298..340
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 634..675
AAA_25 [PF13481], Evalue: 9.30E-05, Aligned region: 219..242
AAA_25 [PF13481], Evalue: 9.30E-05, Aligned region: 274..313
AAA_25 [PF13481], Evalue: 9.30E-05, Aligned region: 388..471
AAA_25 [PF13481], Evalue: 9.30E-05, Aligned region: 631..667
AAA_25 [PF13481], Evalue: 9.30E-05, Aligned region: 805..859
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 203..237
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 635..655
IstB_IS21 [PF01695], Evalue: 0.00012, Aligned region: 746..764
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 215..234
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 632..657
RuvB_N [PF05496], Evalue: 0.00031, Aligned region: 6..33
RuvB_N [PF05496], Evalue: 0.00031, Aligned region: 218..235
RuvB_N [PF05496], Evalue: 0.00031, Aligned region: 274..298
RuvB_N [PF05496], Evalue: 0.00031, Aligned region: 587..657
Arch_ATPase [PF01637], Evalue: 0.00032, Aligned region: 198..232
Arch_ATPase [PF01637], Evalue: 0.00032, Aligned region: 270..303
Arch_ATPase [PF01637], Evalue: 0.00032, Aligned region: 443..500
Arch_ATPase [PF01637], Evalue: 0.00032, Aligned region: 634..656
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 221..238
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 636..664
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 220..239
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 636..657
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 737..754
AAA_33 [PF13671], Evalue: 0.0051, Aligned region: 219..235
AAA_33 [PF13671], Evalue: 0.0051, Aligned region: 634..656
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 188..235
DUF258 [PF03193], Evalue: 0.0067, Aligned region: 634..656
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 220..236
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 450..494
AAA_23 [PF13476], Evalue: 0.0071, Aligned region: 632..724
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 220..257
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 266..298
TIP49 [PF06068], Evalue: 0.0082, Aligned region: 635..671
Protein Sequence: 897 a.a.     [Download]
>gi|218676767|ref|YP_002395586.1| Chaperone ClpB [Vibrio splendidus LGP32]
MININLSSLIQRLHPIVKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDILLSHFDCSETILRQS
IRSTLNTNTTGNGSKPVFSSLLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQHGYASILEGV
NPDTLKRNFSELTTNSLESLATTSEKTDAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIIDILA
RRRKNNPIAVGEPGVGKTAVVEGLALKITEGDVPDCLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDE
VKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQL
VKLDEPSASQAALIIRGLRPAYEKSHNVYVRDDAITAAANLADRYITGRQLPDKAIDVLDTACARVNISL
NATPAPVETLHQEIAAANRELEALERDQLQQTGDKHSAALIPELKEKIEKATEEQATLQVQWKKEQSLIQ
EIIELRSHLYSLTTPSTEEDSAPKADNTIQDDDALTSDKPNCHEYSEEQTREAIQSCNERLDNVRGTNPL
VHYEVGPDEISHVISDWTGIPMGKMLQDESQATLNLKQNLIQNIKGQEFAIDALAEGIQTAKAGLGNPDA
PTGVFLLVGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGFGEGGMLTEAV
RQRPYSVVLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQAKDID
ANIVAEAIRPTLNQHFKPALLARMSVLPFLPLSDAAMTDIIHHKLKKVSERLQSHHKLALCYGDNLVEFV
LGNCRLAETGARNIDAVINRQLLPQLSTQLLVNDKDDSHTQIEVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2694 bp     [Download]
>gi|294510242|ref|NC_011744.2|:1115052-1117745 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGATAAATATAAACCTTTCCTCTTTGATACAGCGTCTGCACCCGATTGTAAAAGTCGCTTTAGAAGATG
CTGCTGCATTAGCGGTATCGGAAAAAGCCAATGAAGTGCAAATTGAACACTATCTATTAAGCTTATTAGA
AAGGCCAAATAGTGATTTTGACATCTTATTAAGTCATTTCGATTGCTCAGAGACCATATTAAGACAATCT
ATTCGTTCTACGCTAAATACCAACACCACAGGAAATGGCAGCAAGCCCGTTTTCTCTTCACTTTTAATCG
AATGGCTTCAAGAAAGTTGGTTAGTCTCGTCTTTAGACCTATCCGAAACTCAGATTCGCTCTGGTGCCCT
ACTTCTTACGCTAGTGAGTAACCCACTACGCTATGGTCAGCACGGTTACGCTTCAATCTTAGAAGGTGTA
AACCCAGACACCTTAAAACGTAACTTTTCTGAACTTACAACAAACTCTCTTGAATCTTTAGCAACGACAT
CTGAAAAAACCGACGCACGTGAAGATGGTTCGGCATTAAGTAAATTCACCACCGACTTTACCGGCAAAGC
AAGAAAGGGCGAGATCGACCCAGTATTCTGCCGTGATCAAGAAATCAGACAAATAATCGACATCTTGGCG
CGACGCAGAAAAAATAACCCAATCGCAGTAGGTGAGCCGGGAGTTGGTAAAACAGCGGTGGTAGAAGGTC
TTGCTTTAAAAATTACCGAAGGAGATGTGCCAGACTGCCTCAAAGGTGTTGAACTATATGGCCTAGACAT
GGGCTTACTTCAAGCAGGAGCAAGTGTAAAAGGTGAATTTGAAAAACGCCTTAACGCAGTACTCGATGAA
GTGAAGAATTCACCGACTCCAATCATTTTATTTATAGATGAAGCTCACACGCTAGTTGGTGGAGGCAATC
AAGCTGGAGGCAGTGATGCTGCCAACCTACTTAAACCCGCTCTAGCACGTGGTGAAGTAAAAACAATCGC
TGCCACCACATGGTCTGAATACAAGAAATATTTCGAAAAAGATCCAGCTCTGGCGCGCCGTTTCCAACTA
GTAAAACTCGATGAGCCATCGGCTAGTCAAGCCGCATTGATCATCCGAGGCTTAAGACCAGCCTATGAAA
AGTCACACAACGTATACGTACGTGACGACGCAATCACTGCCGCAGCAAACTTAGCTGATCGTTACATCAC
CGGACGCCAACTGCCAGATAAAGCAATCGACGTGTTAGATACGGCTTGTGCTCGCGTCAATATTAGCCTC
AATGCAACACCGGCACCTGTTGAAACATTACATCAAGAAATTGCGGCTGCGAATCGCGAGCTCGAAGCTC
TAGAACGTGACCAACTGCAGCAAACGGGTGACAAACACAGTGCCGCTTTAATTCCTGAGCTAAAAGAGAA
GATTGAAAAGGCCACCGAAGAACAAGCTACCCTTCAGGTTCAATGGAAAAAAGAACAATCTCTTATTCAA
GAGATCATAGAACTGCGTAGCCATCTTTATAGCCTTACTACTCCTTCGACTGAAGAAGACAGCGCTCCTA
AAGCTGACAATACGATTCAAGATGATGATGCACTAACAAGTGACAAACCAAATTGTCATGAATATTCTGA
AGAGCAGACTCGTGAAGCTATTCAGTCTTGTAACGAACGTTTAGATAACGTGCGCGGTACCAATCCACTC
GTTCACTATGAAGTGGGTCCCGACGAAATTAGTCATGTAATTTCTGATTGGACAGGCATCCCTATGGGTA
AGATGCTTCAAGATGAGTCGCAAGCCACCTTAAACTTGAAGCAAAACCTAATTCAAAACATTAAAGGCCA
AGAATTTGCCATTGATGCGCTTGCTGAAGGAATTCAAACCGCAAAAGCGGGATTAGGTAACCCAGATGCA
CCAACAGGCGTTTTCTTATTGGTTGGCCCAAGTGGTGTAGGTAAAACAGAAACCGCTCGTGCTATCGCCG
ACCAAATGTTTGGTGGTGAGCGCTTCATGACCACCATCAACATGTCTGAGTTCCAAGAGAAACACACTGT
GTCTCGCCTTATTGGTTCTCCTCCTGGCTATGTTGGTTTTGGTGAAGGCGGTATGCTGACCGAGGCAGTT
CGTCAGCGCCCTTACTCTGTTGTTCTTTTAGATGAAGTTGAAAAAGCAGACCCAGAAGTACTCAACCTGT
TCTACCAAGTGTTCGACAAAGGCACGCTAAATGATGGCGAAGGTCGTACCATCGACTTCAAAAATACGCT
CATCATCATGACGAGTAACCTCGCGACACATGAGATTGAGTCTTTGGTTCACCAAGCGAAAGACATTGAT
GCCAATATCGTCGCTGAAGCCATTCGCCCAACGTTGAATCAACACTTTAAGCCAGCCTTGTTGGCTCGTA
TGTCCGTGTTGCCATTCCTTCCACTTTCAGACGCGGCGATGACTGACATCATCCATCATAAACTGAAGAA
AGTGTCTGAGCGCCTGCAAAGCCACCACAAACTAGCACTTTGCTATGGTGATAACTTAGTAGAATTCGTA
TTAGGAAACTGCCGCCTTGCAGAGACGGGAGCACGAAATATTGATGCCGTAATTAACCGTCAACTATTGC
CGCAGCTTTCGACTCAACTATTGGTGAATGACAAGGATGATTCACATACTCAAATTGAAGTTTCTGTCGA
CGAGCAAGGAACTCTAACCTATGCGTTCAGCTAA