SecReT6
Protein ID: 218688087
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0222
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]243407..243907 [-]
Producthypothetical protein
NoteTssD
UniProt IDB7MQ26
KEGG IDecq:ECED1_0222
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-31, Aligned region: 13..150
Protein Sequence: 166 a.a.     [Download]
>gi|218688087|ref|YP_002396299.1| hypothetical protein ECED1_0222 [Escherichia coli ED1a]
MRLRRITMANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITK
PVDKSSPLLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVS
FTYESINWEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 501 bp     [Download]
>ref|NC_011745.1|:c243907-243407 hypothetical protein ECED1_0222 [Escherichia coli ED1a]
TTGAGATTAAGGAGAATAACAATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGA
TTTCATCCGGATGCTCGTCAATGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCAT
GGTGACGTCACTGTCCCATGGTCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAA
CCGGTGGACAAATCCTCCCCTCTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTG
TATTCTACCGCACCAACCGCTTTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCT
CTCAAACATCGGCCTTACCGTTCCCCATACCATTAACGACAGTCCTGGGCAGGCGGAAGAGTCTGTGTCA
TTTACCTATGAGAGCATCAATTGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAAC
GGATTTTCTAA