SecReT6
Protein ID: 218688089
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0228
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]248819..250327 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7MQ31
KEGG IDecq:ECED1_0228
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-06, Aligned region: 76..133
ImpA-rel_N [PF06812], Evalue: 1.10E-06, Aligned region: 428..439
Protein Sequence: 502 a.a.     [Download]
>gi|218688089|ref|YP_002396301.1| hypothetical protein ECED1_0228 [Escherichia coli ED1a]
MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSL
AHSQLDIPELQRRGLMLLASETKDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRF
AAQVIKRFESAVQDFAGNAATIQRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTS
SARSAAIAPQATTGYVPDMSPHTVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGY
RLRRHALWQTITSTPQAESDGRTPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQ
TALRLGYKQVADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAA
KACFDENGLEAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSL
LKALEQKLTAEQ
 
Nucleotide Sequence: 1509 bp     [Download]
>ref|NC_011745.1|:c250327-248819 hypothetical protein ECED1_0228 [Escherichia coli ED1a]
TTGACGGGCTGGCACGGGTTATTGCGCCGCTACGCGACGCCTGCCACTGGGCGGGAGAATAAGAATATGG
CAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGCTGTC
CGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTCACTG
GCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACCAAAG
ATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCAGGAT
GCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACGCTTT
GCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATACAGC
GCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGCTGGC
AAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGACATCA
TCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCACACGG
TTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATAAAGC
ATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGGTTAC
CGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGGACCC
CACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGGCGCT
GTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGCACAG
ACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCC
GCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTG
GCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCC
AAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATC
CCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGC
ACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTG
CTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA