SecReT6
Protein ID: 218688091
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0230
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]251006..253768 [-]
Productputative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity
NoteTssH
UniProt IDB7MQ33
KEGG IDecq:ECED1_0230
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.60E-39, Aligned region: 255..255
AAA_2 [PF07724], Evalue: 8.60E-39, Aligned region: 640..801
AAA [PF00004], Evalue: 1.80E-16, Aligned region: 221..332
AAA [PF00004], Evalue: 1.80E-16, Aligned region: 646..763
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 40..74
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 6.10E-14, Aligned region: 645..765
ClpB_D2-small [PF10431], Evalue: 1.80E-11, Aligned region: 807..883
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 420..495
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 431..495
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 616..686
AAA_16 [PF13191], Evalue: 1.50E-07, Aligned region: 711..739
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 451..478
AAA_22 [PF13401], Evalue: 3.50E-07, Aligned region: 644..679
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 640..674
AAA_25 [PF13481], Evalue: 1.90E-05, Aligned region: 772..837
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 220..319
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 645..735
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 38..71
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00012, Aligned region: 639..667
NACHT [PF05729], Evalue: 0.00016, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.00016, Aligned region: 448..478
NACHT [PF05729], Evalue: 0.00016, Aligned region: 646..674
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00017, Aligned region: 643..670
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 205..237
DUF258 [PF03193], Evalue: 0.00035, Aligned region: 646..664
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 106..123
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.0059, Aligned region: 646..680
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 220..239
Zeta_toxin [PF06414], Evalue: 0.0088, Aligned region: 644..685
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 220..240
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 646..680
Protein Sequence: 920 a.a.     [Download]
>gi|218688091|ref|YP_002396303.1| putative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia coli ED1a]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLARYAKNMTADARNGRLDPVLCRNYEIDLMIDI
LCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVIFSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAI
NLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLEQYDETLSALDELEVAWQQQQTLVQ
EIIALRQQLLGVAEDDVASLPDADAVEDTPPEAEQDSTDAESADDAGSVQPEETTETVSPVQRLAQLTAE
LDALHNDQLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGGTIKGQDLAIASLHKHLLT
ARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGY
GEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIV
EHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPE
VTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAV
TPQTEDETVL
 
Nucleotide Sequence: 2763 bp     [Download]
>ref|NC_011745.1|:c253768-251006 putative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia coli ED1a]
ATGATCCAGATTGATTTAGCCACGCTCGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATGTGCTGTTACAGATGCTGGC
AATCCCGCGCAACGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGTGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGCGACCAGTTACAGCAGGATTTCGCAGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GCGGGCAAACGCCCCGCGCAACGGAAACCGGCGACACCCTGCTTGCCCGCTACGCCAAAAACATGACCGC
AGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCAACTATGAAATCGACCTGATGATCGACATT
CTCTGCCGCCGCCGTAAAAACAATCCGGTGGTAGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGTGCGTCGGTGAAAGGTGAGTTTGAAAAACGCTTCAAGGGGCTGATG
GCGGAGGTCATTTTCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATATCCAACCTGCTCAAACCAGCGCTGGCGCGCGGCGAGCTGAAAAC
CATCGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATGCAGCTTTGTCGCGCCGCTTC
CAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTTTGTCGGCGGTCT
ATGAACAATCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACACTGAGCGAGCGTTA
TCTCTCCGGGCGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGACACCGCCTGCGCCCGTGTGGCCATC
AACCTGTCATCGCCGCCAAAACAAATCTCGGCACTGACCACCCTGAGCCACCAGCAGGAGGCAGAAATTC
GCCAGCTTGAGCGCGAGCTTCGCATCGGGCTGCGTACCGACACCTCACGAATGACTGAGGTGTTGGAGCA
GTATGATGAAACGCTGTCGGCGCTGGACGAACTGGAAGTCGCCTGGCAGCAGCAGCAGACGCTGGTACAG
GAAATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAAGACGACGTTGCGTCGTTGCCGGACGCAG
ATGCCGTGGAGGATACGCCGCCAGAGGCAGAACAGGATAGTACCGATGCCGAATCGGCTGATGATGCAGG
CAGCGTACAGCCGGAAGAGACCACTGAAACAGTTTCCCCGGTACAACGGCTGGCACAACTCACTGCCGAA
CTGGACGCCCTGCATAACGACCAGTTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGA
TTGCTGAATGGACCGGCGTGCCGCTTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGACCTGCC
GGTATGGCTCGGCGGCACCATCAAGGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACC
GCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTTGGTGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGG
GTAAAACCGAAACCGTCCTGCAACTGGCGGAACTGCTCTATGGCGGACGTCAATACCTGACCACCATCAA
TATGTCTGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGCTCTCCTCCGGGTTATGTCGGCTAC
GGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTCGATGAAGTAG
AAAAAGCGCACCCGGATGTACTCAACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCAGACGGTGA
AGGCCGCCTGATTGACTGTAAAAATATCGTTTTCTTCCTGACCTCCAACCTTGGCTACCAGGTGATTGTC
GAACACGCCGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTG
CTCTGCTGGCGCGCATGGAAGTGGTGCCTTACCTACCGCTGTCGAAAGAGACGCTCGCTACCATTATTGC
CGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGGGCCGGAA
GTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTTATCG
ACGGCGACATGCTGCCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCG
GATTCGCCTGTCGGCGGCAGACGGTGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTG
ACACCGCAAACAGAGGACGAAACGGTTTTATGA