SecReT6
Protein ID: 218688092
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0231
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]253778..254542 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7MQ34
KEGG IDecq:ECED1_0231
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.10E-62, Aligned region: 33..237
Protein Sequence: 254 a.a.     [Download]
>gi|218688092|ref|YP_002396304.1| hypothetical protein ECED1_0231 [Escherichia coli ED1a]
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFTQVVTDVQ
AVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIR
EPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQL
IRRLTIKHVLCGGLVVLTVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 765 bp     [Download]
>ref|NC_011745.1|:c254542-253778 hypothetical protein ECED1_0231 [Escherichia coli ED1a]
ATGAGCGATATGAGTGAAGCGTCGGTTTTTCCCGTGGAGCCGGAGAGCGGAACACCAGGACGCCAGTACC
GTCTCGCCCTTCGCGGCAACAGCCTGAATCCAATGATTGACGCCGCCACGCCGTTGCTCGGCATGGTGAT
GCGTCTGTCCACTATGAACAGTCAGGCCATGCCGGAACATCTGTTTACCCAGGTAGTAACCGATGTCCAG
GCCGTAGAGCAACTACTCCAGGAACAGGGATACGAACCGGGCGTCATTGTTTCGTTCCGTTACATTCTCT
GCACGTTTATTGATGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATCAAACAGTCGCT
GCTGGTTCATTTTCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGCCTGATCCGG
GAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGTTTTTCGCTCGGCTTTCGCGGGCGCT
ACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGCCCTGCACAA
ACTGCGCGGTGACGCGCCATTTCCGCTACTTCATCAGAAGAACAACATACAGGGTGGGCGTTATCAGTTA
ATCCGACGACTGACCATCAAGCATGTACTGTGCGGCGGTCTTGTTGTGCTGACCGTATTTTATCTGTTTT
ATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCGATAA