SecReT6
Protein ID: 218688093
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0232
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]254547..255893 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7MQ35
KEGG IDecq:ECED1_0232
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|218688093|ref|YP_002396305.1| hypothetical protein ECED1_0232 [Escherichia coli ED1a]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATINDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPYHEGYVYFELEKGTPAWQ
DVIKAGALALHISGSFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_011745.1|:c255893-254547 hypothetical protein ECED1_0232 [Escherichia coli ED1a]
ATGGCAACAATGAAAAACAAAGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCACTGCGAGTACCTGCTGACCCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGTTTTAC
GGAACTCTCCATCAATACAGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCGGTGATAAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCAGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACTCTCCCCCTGTGCCGTATCCTCAATAAAAATGCCACCGGCGCGCTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGACTGCTTGCCACCCGCGCCGCTGACCTGGCCGGGCGCATTGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCTATCAAATGCAGTTCACGCATCGTTCCCA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCGGGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCGCTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGTT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAACGATCCCACATTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCGAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACGCTTACCGCTGC
GCCACGTCAGTTGCCATACCACGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCGGCCTGGCAG
GACGTGATAAAAGCGGGCGCACTGGCGCTGCATATCTCCGGCAGCTTCCCCGATCTGAACCTCCAGCTCT
GGGCTATAAGGGGATAA