SecReT6
Protein ID: 218688094
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0233
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]255896..256420 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7MQ36
KEGG IDecq:ECED1_0233
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|218688094|ref|YP_002396306.1| hypothetical protein ECED1_0233 [Escherichia coli ED1a]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_011745.1|:c256420-255896 hypothetical protein ECED1_0233 [Escherichia coli ED1a]
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTCGTATTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGATGGCGAAGCCGCTCCGGTGGATGTCCAG
TTGGTTTATCTGAGCGACGACTCAAAATTCCATGCCGCCGACTACGACCAGGTTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAAAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGATACCGTAAAAACACT
GCCGCCGATCAAGTTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCGGACGACCAGGCC
ACAGAATGGAAACAAATTGAGTCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA