SecReT6
Protein ID: 218688095
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0234
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]256417..257709 [-]
Producthypothetical protein
NoteFha
UniProt IDB7MQ37
KEGG IDecq:ECED1_0234
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00097, Aligned region: 44..108
Protein Sequence: 430 a.a.     [Download]
>gi|218688095|ref|YP_002396307.1| hypothetical protein ECED1_0234 [Escherichia coli ED1a]
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIR
HDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDS
LADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANG
INTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLS
LQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVE
ALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDDAWAWQMYSNYYDELGSSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
 
Nucleotide Sequence: 1293 bp     [Download]
>ref|NC_011745.1|:c257709-256417 hypothetical protein ECED1_0234 [Escherichia coli ED1a]
ATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATG
GCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATAC
GCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGG
CACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCG
ATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCA
TGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGT
CTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTG
CCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGC
AGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGG
ATCAACACGCCGTTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCA
TGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTC
TCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGT
CTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCGTTGCGCCTTG
ATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACC
TGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGCGATTGTGGAA
GCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCA
GCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAGCT
GGGCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTG
CTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA