SecReT6
Protein ID: 218688096
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0235
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]257714..258763 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7MQ38
KEGG IDecq:ECED1_0235
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-91, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|218688096|ref|YP_002396308.1| hypothetical protein ECED1_0235 [Escherichia coli ED1a]
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSSDASISFPGTD
LSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>ref|NC_011745.1|:c258763-257714 hypothetical protein ECED1_0235 [Escherichia coli ED1a]
ATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAGCGACAAAACCGCCGTTACCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGCATGGCGCGCCGGGCCAGGACATTTCCCT
GCGTACCGAGCCTGCCCGGGAGATCGTGCGTTTCAGCTCTGACGCCAGTATCAGTTTTCCGGGTACGGAC
CTGAGTGCGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGGTTCCTGGGTTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAGCGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTGGCGCCACAGCAGGCTAAAGGGATGCGCCTTGGCGATCCGGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA