SecReT6
Protein ID: 218688097
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0236
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]258727..260586 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7MQ39
KEGG IDecq:ECED1_0236
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.90E-190, Aligned region: 11..619
Protein Sequence: 619 a.a.     [Download]
>gi|218688097|ref|YP_002396309.1| hypothetical protein ECED1_0236 [Escherichia coli ED1a]
MCGVISVAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEF
PEFTHGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVS
SVACHFTLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYL
WFCECLMDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAP
LPDDFPINAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAY
DIFQVSTVTSKVKFSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVH
ADGSIPGSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWS
LISAMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTL
WIRPDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1860 bp     [Download]
>ref|NC_011745.1|:c260586-258727 hypothetical protein ECED1_0236 [Escherichia coli ED1a]
TTGTGTGGAGTGATCTCTGTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGC
TAGGCAAACTGCTGGCGCAGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGA
CGTGGAGCGTCTGATGGAAGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTC
CCCGAGTTCACCCATGGGCTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGG
TTATTGCCTATGAACCCAAAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAG
AAGCCGCTCAGAAAAGTCCTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCT
TCCGTAGCCTGCCATTTCACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCA
ACGCCAGCAGCCTGAAAGAAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCAT
GCTTGACCTGAACAAAATCACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTG
TGGTTTTGCGAATGCCTGATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGT
GGCTGGAGGCGGCGGGTTTTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTA
CCGCGTGCTTCAGGAGTATTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCG
CTACCAGACGATTTCCCGATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACA
TCAAGCTGCGCCAGGATTCGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGA
ACCCGTCAGGCCGGATGGGCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTAT
GACATTTTTCAGGTCAGCACAGTCACCAGTAAAGTCAAATTTTCAGGTACTGAAATCAGCCCAGGTAGCC
AGGCGCGTGTCTGGCCCGAATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGAGAGAAGTCGT
CTACTGGCATCACCGGACTAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCAT
GCAGACGGTAGCATTCCGGGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCA
ACCGTATGATCCCTGCCCGGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGC
CTCATTTCGTAATGTCACGCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCG
CTGATTTCCGCGATGAACCTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGA
CCTTCGACCTGCCAGGTGCTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGA
AAAACTCGAAACCAAACCTGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTG
TGGATACGTCCCGATCCGTTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCT
TTGCCCTCTACGCCAGCATCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTG
GGAATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAG