SecReT6
Protein ID: 218688098
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0237
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]260574..260999 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7MQ40
KEGG IDecq:ECED1_0237
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|218688098|ref|YP_002396310.1| hypothetical protein ECED1_0237 [Escherichia coli ED1a]
MLRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELCFHIVATVDVSETRGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>ref|NC_011745.1|:c260999-260574 hypothetical protein ECED1_0237 [Escherichia coli ED1a]
ATGCTAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGTTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCTGCACCAGATGAATACGCCCCTGTGGAACTGTGTTTTCATATTGTGGCTACGGT
CGATGTCAGCGAAACCAGGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA