SecReT6
Protein ID: 218688099
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0238
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]261004..262488 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7MQ41
KEGG IDecq:ECED1_0238
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-181, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|218688099|ref|YP_002396311.1| hypothetical protein ECED1_0238 [Escherichia coli ED1a]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYQGLTAPRFLLRHPYSPDENPVKTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>ref|NC_011745.1|:c262488-261004 hypothetical protein ECED1_0238 [Escherichia coli ED1a]
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCA
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGCTGCTGAAATATATCAGCCAGGTCAGCGCGATGGC
GCACAGCCCGTTCCTGTCGTCAGTATCATCCGAATTTTTCGGTCTGGATTCATGGACAGAGTTACCGGGG
ATCAAAGAACCGGGTGCCATCTTTGAAGGCCCGGCCTACTCCCGCTGGCGCGCCCTGCGTGAATCGGAAG
ATTCCCGTTACCAGGGCCTGACCGCCCCCCGGTTCCTGCTGCGCCACCCTTACTCACCGGATGAAAACCC
TGTCAAAACCTTCCGTTACCATGAAGATGTCAGCCAGAGTCATGAGTCTTATCTGTGGGGGAATACCTCG
TTTTTACTGGCCGCCAACCTGGCGGAAAGTTTTGCTAAGTATCGCTGGTGCCCAAATATTATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAGGGCTTTATCACACTGACC
ATGCGTAAAGGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAACATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACCCAGCTGCCATACTTGTTTGTTAT
CAGCAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGTAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCAGGAAAATCCGCCTGCCGAAGTCC
GCAGCCACCGGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTGGATGGTGAGCCGGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGCCTGGTCGGACGA
CTGGATAAGGAATAA