SecReT6
Protein ID: 218688100
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0239
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]262511..263065 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7MQ42
KEGG IDecq:ECED1_0239
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-48, Aligned region: 27..179
Protein Sequence: 184 a.a.     [Download]
>gi|218688100|ref|YP_002396312.1| hypothetical protein ECED1_0239 [Escherichia coli ED1a]
MYAVRKCCAHGLNGNIFMSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPL
DERTAIAINRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLEL
REALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 555 bp     [Download]
>ref|NC_011745.1|:c263065-262511 hypothetical protein ECED1_0239 [Escherichia coli ED1a]
TTGTATGCAGTACGAAAATGCTGTGCTCATGGCCTGAACGGGAACATTTTTATGAGCAAAATGAACAACA
ATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAAAAGTTGATGGGGTGGCTGC
TGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAAACCAGATAACACGCCGTTG
GATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATTTCAGAAGCTGACATTGAAC
GGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGTACGTCAACCTGAAAGTCAA
ATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAATAAAACGTCTGCTCGAATTG
CGTGAAGCCCTGGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTCCGCGCACAACTTCAGGCGC
TACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCGCCGTTCAGAAATAA