SecReT6
Protein ID: 218688101
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0240
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]263724..264242 [+]
Producthypothetical protein
NoteTssD
UniProt IDB7MQ43
KEGG IDecq:ECED1_0240
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0035, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|218688101|ref|YP_002396313.1| hypothetical protein ECED1_0240 [Escherichia coli ED1a]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKFGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_011745.1|:263724-264242 hypothetical protein ECED1_0240 [Escherichia coli ED1a]
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCGCAGTCTGGTCAGCCTTCCGGGCAGCGTGCTCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACCTCTGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCATATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCCTACCGTAAGGTTGAGTGGGAGCACATCAAATTCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA