SecReT6
Protein ID: 218688102
SecReT6 ID319
T6SS typei1
Gene symbol-
Locus tagECED1_0241
StrainEscherichia coli ED1a
Repliconchromosome [GenBank: NC_011745] [Browse all T6SS(s) in this replicon]
Location [Strand]264463..266694 [+]
Productputative VgrG/E protein associated with Rhs elements
NoteTssI
UniProt IDB7MQ44
KEGG IDecq:ECED1_0241
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-62, Aligned region: 34..328
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 546..563
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 558..577
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 578..594
Gp5_C [PF06715], Evalue: 5.00E-07, Aligned region: 612..620
Protein Sequence: 743 a.a.     [Download]
>gi|218688102|ref|YP_002396314.1| putative VgrG/E protein associated with Rhs elements [Escherichia coli ED1a]
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATLTIWQGVIPQR
YVTGVVAGFGMQENNGWQMRYHLCIEPPLWRCGLRQNFRIFQQQDIRTISATLLNENGVTEWTPLFYEDH
PAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQKLTLCDDVAGLSQAGEFPFNPDTSAGAETEC
VSMFRYEAHVRPSSVQSQDYTFKVPDWPGMYEQQGESLNGQLEQYEIFDYPGRYKDEQHGKDFTLYRMES
LRSDAEKATGQSNSPKLWPGTRFTLTEHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIP
ADRTWRPRVQSKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYHGMTEESSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPVVMGRTYHEDNRSPGDLPGTKTQMTIRSKTYKGSGFNELRFEDATD
KEQVYIHAQKNMDTEVLNDRTTDVKHDHTETIGNDQKITVGLGQTVNVGSKKEGGHDQKVIVANDRCITV
RNDQMLKVTNDRTVSVSHDDSLYVRNDRWVTVKGKLEHRTTGNHISQVEGKHSLEVKGDLARKISGALGM
KVRDEIVLESGGKITMKVGGSFVVIHSGGVDIVGPKINLNSGGSPGAPVPTLQPAVLKALADDKSLAAEQ
NDSNASSDQNDNNDEGEEAPEKSVCKECLKRAQEAAAAFAPRG
 
Nucleotide Sequence: 2232 bp     [Download]
>ref|NC_011745.1|:264463-266694 putative VgrG/E protein associated with Rhs elements [Escherichia coli ED1a]
ATGTCCTTAAAAGGTCTTCGCTTTACGCTGGAGGTTGACGGCCAGGAGCCGGACACCTTTGCAGTGGTGA
ATTTCAGGTTAATCCAGAACCAGTCTTATCCGTTTGTGATGAGTGTGGATGTCGCCAGCGATTCTTTTAT
GCAGACGGCGGAGATGCTGCTGGAGAAGAAGGCAACGCTAACCATCTGGCAGGGCGTCATCCCGCAGCGT
TATGTCACAGGCGTGGTGGCGGGCTTTGGCATGCAGGAGAACAATGGCTGGCAGATGCGTTACCACCTGT
GTATTGAGCCGCCGTTATGGCGGTGCGGGCTGCGGCAGAACTTCCGCATCTTCCAGCAGCAGGATATCCG
GACGATATCGGCCACGTTACTGAACGAGAACGGCGTCACGGAGTGGACGCCGCTGTTTTATGAGGACCAT
CCGGCGCGGGAGTTCTGTGTCCAGTACGGGGAAAGCGACCTGGCGTTTCTGGCGCGGCTGTGGGCGGAGG
AGGGGATTTTCTTCTTTGAGCGGTTTGCGGCGGACAGTCCGGAGCAGAAGCTGACGCTGTGCGACGATGT
GGCGGGGCTGTCACAGGCGGGAGAGTTTCCGTTTAACCCGGACACATCGGCAGGAGCGGAGACGGAGTGT
GTCAGTATGTTCCGTTATGAGGCGCATGTCCGCCCGTCATCGGTGCAGAGCCAGGATTACACGTTTAAGG
TGCCGGACTGGCCGGGGATGTATGAGCAGCAGGGTGAGAGCCTGAACGGACAGCTTGAACAGTATGAAAT
ATTTGATTATCCGGGAAGGTACAAGGATGAACAGCACGGCAAGGATTTCACGCTGTACCGGATGGAGAGC
CTGCGCAGTGATGCGGAAAAGGCCACAGGGCAGAGTAATTCGCCGAAGCTGTGGCCGGGGACGCGGTTTA
CGCTGACGGAGCATCCGCAGAAGATGCTGAATCGTGAATGGCAGGTGGTACAGAGCATTCTGTCAGGAGA
CCAGCCGCAGGCGCTTCATGGCAGCCAGGGGAGAGGAACCACGCTGGGAAATCAGTTAGAGGTGATACCG
GCGGACCGGACCTGGCGTCCACGGGTGCAGAGCAAACCGAAGGTGGACGGGCCGCAGAGTGCGATAGTGA
CGGGGCCAGCGGGAGAGGAGATTTTCTGCGACGAACATGGTCGGGTACGGGTGAAGTTTCACTGGGACCG
TTATCACGGGATGACGGAGGAGAGTTCGTGCTGGGTGAGGGTGTCACAGGCGTGGGCGGGGCCGGGGTTC
GGTAACCTGGCGATACCGCGTGTGGGTCAGGAAGTGATAGTGGACTTCCTGAACGGGGACCCGGACCAGC
CGGTGGTCATGGGCAGGACGTACCATGAGGACAACCGTTCACCAGGGGACCTGCCGGGGACGAAGACGCA
GATGACGATACGGTCGAAGACCTATAAAGGAAGCGGGTTTAACGAGCTGCGCTTTGAGGATGCGACGGAT
AAGGAACAGGTCTATATCCACGCGCAGAAGAACATGGACACGGAGGTACTTAACGACCGGACGACGGACG
TTAAGCATGACCACACGGAAACCATTGGTAACGACCAGAAGATAACGGTGGGGTTGGGCCAGACGGTGAA
TGTGGGGAGCAAAAAGGAAGGTGGTCATGACCAGAAAGTGATAGTGGCGAACGACCGGTGCATCACGGTA
CGTAACGACCAGATGCTGAAGGTGACGAACGACCGGACGGTGAGCGTGAGTCACGATGACAGTCTGTATG
TCAGAAATGACCGCTGGGTGACGGTGAAAGGGAAGCTGGAGCACAGGACGACGGGGAACCATATCAGCCA
GGTGGAGGGGAAGCACAGCCTGGAGGTGAAAGGCGACCTAGCGAGGAAGATTAGCGGTGCGCTGGGAATG
AAGGTCCGGGATGAAATCGTACTGGAGAGTGGCGGTAAAATCACCATGAAAGTGGGTGGTTCGTTTGTGG
TCATCCATTCAGGGGGCGTGGACATCGTCGGGCCGAAAATCAATCTCAATAGCGGCGGTAGTCCGGGAGC
GCCGGTGCCGACGCTGCAACCGGCGGTTCTGAAAGCGCTGGCAGATGATAAAAGTTTAGCGGCTGAGCAA
AATGATAGTAATGCATCGTCCGATCAGAATGATAACAACGATGAGGGTGAGGAAGCGCCAGAAAAATCGG
TGTGTAAGGAGTGCCTGAAAAGGGCGCAGGAAGCAGCCGCCGCTTTTGCGCCTCGTGGATAA