SecReT6
Protein ID: 218693681
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0219
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]242401..243843 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7LHC5
KEGG IDeck:EC55989_0219
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.50E-44, Aligned region: 169..184
DUF3702 [PF12486], Evalue: 9.50E-44, Aligned region: 322..466
ImpA-rel_N [PF06812], Evalue: 6.00E-21, Aligned region: 71..130
Protein Sequence: 480 a.a.     [Download]
>gi|218693681|ref|YP_002401348.1| hypothetical protein EC55989_0219 [Escherichia coli 55989]
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPEL
NWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLD
WFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACS
VAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADS
RWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYHDARAQKQNTDALEKQINERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c243843-242401 Escherichia coli 55989 chromosome, complete genome
GTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACAC
ACTGTACTGAGGAGGCAGGGATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCG
CGGGCTGCCGGAATTCAGCGCCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTG
AACTGGAAACTGGTGGAGTCGCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCA
CCTACTATACGCTTGCCCGGACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGC
GGCAATGGTAAGCCACGACTGGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGAC
TGGTTTAACTCCCGAACCGGCAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGA
TCTACCGCACAGAGCGGGCATTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCC
GCGCGTGGAGAATCTGCTCTATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAAC
ACTGAGAACGCCGCACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACAC
CAGAAGCGGTAGTGCCTCCCCTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAA
TCCCCCACAGGCCAGTGTGATAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCA
GTGGCTGTCGCCTCAGCATTGTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACG
ACACCGCTCAGGGCGCAGCAACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCA
ACAACTTCTTGATACCTCCCCGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGT
CGCTGGCCGGAAAGCCTGCAACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCAC
AGAGTAGCCCGCAGTTGCGTGGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGAT
GCAGCGCGAGAAAGAGGGACTAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTG
GGGCAGGAAACACCCGTTGAGTCTCTGTTGACGCAGTACCATGATGCCCGTGCGCAGAAGCAGAATACAG
ATGCGCTGGAAAAACAAATTAATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAA
CGTCATGCCAGAGGCGGCAACCGGTACCACGGCCGAAAAATAA

Protein ID: 218693683
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0221
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]247307..248788 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7LHC7
KEGG IDeck:EC55989_0221
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-07, Aligned region: 76..133
ImpA-rel_N [PF06812], Evalue: 1.90E-07, Aligned region: 174..208
Protein Sequence: 493 a.a.     [Download]
>gi|218693683|ref|YP_002401350.1| hypothetical protein EC55989_0221 [Escherichia coli 55989]
MTGWQGRLLPCAMPATGRENKNMAMDLRDPNVWVSHLLENLPEEKLASALKDDNPDWEYIDGGIVKLGSL
AHSQLDIPELQHRGLVLLASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWAVAAPQNMAHKKRF
ASQVIKRFETGIDAFSQNAATAQRDALLGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPAP
TPAASSSSPQTIATSESGVTHTSTPTPQIAIDSHDDKTWRDTLLKVAAILCERQPESPQGYRLRRHALWL
TITSTPQAKSDRRTPLAAVSADMVADYQSRLASADMELWQQVEKSVLLAPYWLDGHYISAQTAHRLGYTA
VADAIRDEVVSFLGRLPALADLLFNDHTPFVSEKTKQWLANQPGNQSAPVIQVSNEDIQAARLCFDEQGL
EAALRYLDTLPAGEPRDQFHRQYFGAQLMEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFT
AEQ
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c248788-247307 Escherichia coli 55989 chromosome, complete genome
TTGACGGGCTGGCAAGGGCGATTGCTCCCCTGCGCGATGCCTGCCACTGGGCGGGAGAATAAAAATATGG
CAATGGACTTACGCGATCCGAATGTCTGGGTATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAACTGGC
ATCGGCGCTGAAGGACGACAACCCGGACTGGGAGTATATCGACGGTGGGATTGTCAAACTGGGATCGCTG
GCGCACAGCCAGCTGGATATCCCTGAACTCCAGCACCGGGGACTGGTCCTTCTGGCTTCGGAGAGTAAGG
ATTTTCGCCTGCTGGCGCATCTGCTGAGAACCCTGCAACATGCCGGTGATCCGCTCCTGGCCTTGCGCCT
GCTGGCGCTGTATGTGGAGCATTACTGGGCGGTAGCCGCGCCGCAGAATATGGCACATAAAAAACGCTTT
GCCAGCCAGGTTATTAAACGCTTCGAAACAGGTATTGACGCTTTTTCACAGAACGCCGCCACAGCGCAGC
GCGATGCGCTGCTAGGTGAACTGGCGAAACTGGCGCAATGCTGGCAGTCACATAATGCCCCGGAACTAGC
ACAGGCTACTGATGATCTTTTTGCCCTTTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCAGCCCCC
ACTCCGGCGGCCTCCAGTAGTTCACCACAGACGATCGCCACGTCTGAAAGCGGCGTGACGCATACCAGTA
CTCCGACTCCACAGATCGCCATCGACAGTCACGACGACAAAACCTGGCGCGACACACTGTTAAAAGTGGC
GGCCATTTTATGCGAGCGCCAACCGGAATCGCCGCAGGGCTATCGCCTGCGTCGCCATGCCCTGTGGCTA
ACCATCACCAGTACGCCCCAGGCGAAAAGCGATAGACGTACTCCACTGGCTGCGGTCTCTGCCGATATGG
TGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGAGCTGTGGCAGCAGGTGGAAAAAAGCGTACT
GCTGGCACCCTACTGGCTGGACGGTCACTACATTTCTGCACAGACGGCGCACCGTCTTGGTTATACCGCT
GTAGCCGATGCCATCCGCGATGAAGTCGTTTCCTTTCTTGGCCGTCTGCCCGCGCTCGCTGATCTTCTGT
TTAACGACCACACACCGTTTGTTTCTGAAAAAACGAAGCAATGGCTTGCAAATCAGCCAGGTAACCAGTC
CGCGCCAGTCATACAGGTGAGTAATGAAGATATTCAGGCTGCGCGGTTGTGTTTTGATGAGCAGGGGCTG
GAAGCCGCCTTACGGTATCTGGATACGTTACCCGCCGGTGAACCCCGCGACCAGTTCCACCGGCAGTATT
TTGGCGCGCAGCTTATGGAAGAGGCGGGGCTGGTACAGCTTGCGCAACAGCAGTACAGGATGTTGTTCAG
GATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCACG
GCAGAACAATAA