SecReT6
Protein ID: 218693686
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0224
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]252235..252996 [-]
Productmembrane protein Aec26
NoteTssL
UniProt IDB7LHD0
KEGG IDeck:EC55989_0224
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-60, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|218693686|ref|YP_002401353.1| membrane protein Aec26 [Escherichia coli 55989]
MDEGSLSLPPFTGYDEKSQRNYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWICFSLGFRGRYKVAAQDQGEFEQIYRRLYHVQHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c252996-252235 Escherichia coli 55989 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCAGCGCAACTACCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACGGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCAAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGAGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGATCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCAGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA