SecReT6
Protein ID: 218693689
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0227
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]254856..256157 [-]
Producthypothetical protein
NoteFha
UniProt IDB7LHD3
KEGG IDeck:EC55989_0227
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 433 a.a.     [Download]
>gi|218693689|ref|YP_002401356.1| hypothetical protein EC55989_0227 [Escherichia coli 55989]
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVILHD
GTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDML
TDTLLSTEGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGG
INTPFMDLPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKG
LLDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAA
IVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c256157-254856 Escherichia coli 55989 chromosome, complete genome
ATGATAATCACGGAGCAGAATATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCA
GTGAGCTGGAAAGCGGACGGGCGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGGCCCCGA
ATGCCACTGGTCGGTACAGGATCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGAT
GGCACATTTTGTCTGCGCCCGCAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAG
ACCTAATACAGTTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCG
GGGAGATATTCCCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTC
ACGGATACCCTGCTATCAACGGAGGGTACGCCACACTATCCGGGAATGACTCACCGGCACCAACTTGCAG
ACACCGTGGTAAACGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGG
CGATCCGCTTTCAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGG
ATCAATACTCCGTTTATGGATCTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTG
CGGCAGAAATGGCGCAACGCCACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCAT
GAGCAATTCCGACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGT
CTGCTCGATTTGCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGC
TGCGCCTGAACATGGATTACGCCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATTT
GGCGGCTCCCGCCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCG
ATTGTGGAGTCGCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGT
ACCGCCGCAGCCATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTA
CGAAGAACTGGCCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTAT
GACCGGGTGCTTCGTGAAAAACAGCGGGAGCCGGAAGCATGA