SecReT6
Protein ID: 218693690
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0228
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]256161..257249 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7LHD4
KEGG IDeck:EC55989_0228
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-93, Aligned region: 35..349
Protein Sequence: 362 a.a.     [Download]
>gi|218693690|ref|YP_002401357.1| hypothetical protein EC55989_0228 [Escherichia coli 55989]
MEMDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQE
TLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMF
SHRLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPE
IICGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SITSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTP
EERPSVTIRVRS
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c257249-256161 Escherichia coli 55989 chromosome, complete genome
ATGGAAATGGACGGAAAGAATCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAG
AGCAGAATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCT
GTTGCACCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGTGACGATCCGGCACAGGAA
ACCCTGCGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATA
CATCAGGGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTA
TTACCTCGATCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTC
AGCCACCGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACG
GCGGTGTGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAA
GCTGGCGATTAATCACAGCAAAATGCTGGCGTATTCCGGTATCCTGGCAAATCCGGGACGATCCCCGGAA
ATAATCTGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACGCTGCAAAACTGGCAACGTCGCA
AGGTGGATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGC
GGGAAGATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTGCCCGATCTCAGCGGAAAATTCCAGCTC
AGTATTACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGA
CGATGTTCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCA
GGTGGGCGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCG
GAAGAACGACCCTCAGTCACCATCAGGGTACGGTCGTAA