SecReT6
Protein ID: 218693695
SecReT6 ID320
T6SS typei1
Gene symbol-
Locus tagEC55989_0233
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]261266..261766 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7LHD9
KEGG IDeck:EC55989_0233
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|218693695|ref|YP_002401362.1| hypothetical protein EC55989_0233 [Escherichia coli 55989]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c261766-261266 Escherichia coli 55989 chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCCCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACGCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA