SecReT6
Protein ID: 218696589
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3287
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3376123..3377553 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7LFQ4
KEGG IDeck:EC55989_3287
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.50E-64, Aligned region: 26..452
Protein Sequence: 476 a.a.     [Download]
>gi|218696589|ref|YP_002404256.1| hypothetical protein EC55989_3287 [Escherichia coli 55989]
MYGYYCMQEEEQLVYWYSGLYLQPQHFQSIDLHHGFMLARSRQLSQPHHQGYYECCINDDLLKEDTVRVE
KIKAVLSSGYYIEYPGNCVVQDKCLTNLKGSDHGTVDLWLALKRFNSGHKNVSSVNDKRGSARWISSDDE
RNMRNVYHDSQDADITRIKYDIQILTDEEKDNTTDYEYLPLTRIIYGNNSLCIDDECSFPVMRLSANHKL
RNKIAEIYSDIKFYKNRLEKYRYTERTVSDGHLYNFLILCAINRTLPLLSSFINEDAIHPWLYYMALCQF
AGEISTFHNSGLSDTRIVELSYNHYEQISCFSDLQYYIKLILDDSCRDKIISVEFRKITTDTLICNFDEY
GAGSNSDYYIKLTSDTFRKNKLIALPEIKIAPSEHIDMIIQHALPGIKFTVMDAVTSDLQVRENTIWLKI
DKHSELWTLAQTQKRVAFYWSCSPDDLLVELVLSQEKYAVSRPKQDNGSFHPAVGR
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3377553-3376123 Escherichia coli 55989 chromosome, complete genome
TTGTACGGGTATTACTGCATGCAAGAAGAAGAACAACTTGTTTATTGGTATTCAGGGCTCTATTTACAAC
CTCAGCACTTTCAGTCAATTGACTTGCATCATGGCTTCATGCTTGCCAGAAGCAGGCAGTTATCACAACC
CCATCATCAGGGGTACTATGAATGTTGTATCAATGATGATCTTCTTAAGGAAGATACTGTCAGAGTTGAA
AAAATAAAGGCTGTTTTATCTTCAGGGTATTATATCGAGTATCCGGGTAACTGTGTGGTACAGGATAAGT
GCCTGACAAATCTCAAAGGTTCAGATCACGGTACCGTGGATTTGTGGCTTGCGCTTAAGAGATTCAATTC
CGGTCATAAAAATGTCTCCAGTGTTAATGATAAACGAGGCTCTGCCAGATGGATAAGTTCAGATGATGAA
CGTAACATGCGTAATGTTTATCATGACAGTCAGGATGCCGATATTACAAGAATAAAATATGATATTCAGA
TTCTTACAGATGAGGAAAAAGATAATACTACAGACTATGAGTATTTACCCCTGACAAGGATCATATATGG
AAATAATTCATTGTGTATTGATGATGAGTGTTCATTTCCCGTGATGAGGTTATCTGCGAATCACAAACTT
AGAAATAAGATCGCAGAGATCTATTCGGATATTAAGTTCTACAAAAATAGACTGGAGAAATACAGATATA
CAGAACGAACAGTGTCCGATGGACATCTTTATAACTTTTTAATTCTATGTGCTATTAATAGGACATTACC
ACTTCTTTCTTCATTCATTAATGAAGATGCCATTCACCCATGGTTGTATTATATGGCATTATGTCAGTTT
GCAGGGGAAATATCTACATTTCATAACTCTGGACTTTCAGATACTAGGATTGTCGAACTATCATACAATC
ATTATGAGCAGATCTCATGTTTCAGTGATCTGCAGTATTATATTAAGTTAATACTGGATGATTCATGTCG
AGATAAGATTATTAGTGTTGAATTCAGAAAAATAACTACTGATACATTGATCTGTAATTTCGATGAGTAC
GGTGCCGGAAGTAATTCAGATTACTATATTAAGTTAACCTCAGATACCTTCAGAAAGAATAAGCTGATTG
CATTGCCAGAGATTAAGATTGCTCCATCTGAACATATCGACATGATAATTCAGCATGCTCTTCCAGGAAT
CAAGTTTACAGTGATGGATGCCGTTACATCTGATTTGCAGGTAAGAGAGAATACAATCTGGTTAAAGATA
GATAAACATTCAGAATTATGGACGTTAGCTCAGACTCAAAAAAGAGTTGCATTCTATTGGTCATGTAGTC
CTGATGATTTACTTGTAGAGTTAGTATTATCGCAGGAAAAGTATGCCGTAAGCAGGCCTAAACAGGATAA
CGGTTCTTTCCATCCGGCGGTTGGCAGATAA