SecReT6
Protein ID: 218696590
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3288
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3377554..3378108 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7LFQ5
KEGG IDeck:EC55989_3288
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-18, Aligned region: 16..153
Protein Sequence: 184 a.a.     [Download]
>gi|218696590|ref|YP_002404257.1| hypothetical protein EC55989_3288 [Escherichia coli 55989]
MMTIKCLLLAVMVFPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNEISNSCALLF
LQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHIDRNEGTKYVGVVAGYYPFPG
KQHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESISMK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3378108-3377554 Escherichia coli 55989 chromosome, complete genome
TTGATGACTATTAAGTGCCTGCTACTAGCGGTTATGGTATTCCCCTTTTTCATCACTGCCTGTTCTGATA
AGTATTCTGAACAGGATAGAGTGCAGGCTATCAACAATGCCGATGCTCCATTTGGCGCCGGCTTGCTTAC
TTTTCAGATATCATCTGATACGCAATTAAACTCACTTAACGAGATATCCAACAGCTGTGCATTATTATTC
TTACAGGCTTCAGATAAAAATACATTACAGGACATAATGAATAATCCTGTGTTAATCAAACAGTTTTTTA
TCGGGACAGGTAAGGTTGATGGCATTCTTAAAGTTGATAAATACGTGGCTATGCCGGGGCAGGAGATAAC
GCTACATATAGACAGGAATGAAGGGACTAAATATGTAGGTGTGGTTGCTGGATACTATCCATTTCCTGGA
AAACAGCATATGTTACTCTTAGATATTCCGGTTGATGTTGTTGAGGAAGGTTGGTGGAATAAATCATTAC
ATGCATCACTCTTACCTCTTTCCAAAAAGATATCGATGGGTAAAGAAAGTATCAGTATGAAATAA