SecReT6
Protein ID: 218696591
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3289
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3378113..3379189 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7LFQ6
KEGG IDeck:EC55989_3289
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-22, Aligned region: 57..117
Protein Sequence: 358 a.a.     [Download]
>gi|218696591|ref|YP_002404258.1| hypothetical protein EC55989_3289 [Escherichia coli 55989]
MNKIETDTLLLPVIGESPAGDDIEYDPVYSEIREARQNDPDYMSQGEWAVSEPRRADWRKVRKLCEVTLR
NKSKDLQISCWYVESLTHLYALEGMHCGLEYLAKFISQYWTTCWPSQEEGQEIRYSKLVRLDIDLSEYLK
AYPLLEDKEITLSEWYKVLSFEHGASLSEAGKERLIESEGDHSVESFKRAVGKYNPRKVSEQLLQLYDLP
DKIDEIESSYFFHTHEDIHHIFAKTRHIISEITELLSRFLPQETLDHSSVSQFLGKPDSRDTRTALPEEK
KEFYSALTPSTDKEMSREKAIEQLEKIAIFFRQSEPTSPVPYLLERAIRWSTMTMSEWLEELLKDNDSME
QINRVLKG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3379189-3378113 Escherichia coli 55989 chromosome, complete genome
ATGAACAAAATAGAAACGGATACATTACTGCTTCCTGTTATAGGAGAATCGCCGGCAGGTGATGATATTG
AGTATGATCCGGTGTATAGCGAAATACGGGAGGCAAGACAAAATGATCCGGACTATATGTCTCAGGGGGA
ATGGGCTGTCAGTGAACCCCGCAGAGCTGACTGGAGAAAAGTAAGAAAATTATGTGAGGTTACTTTACGT
AATAAGAGTAAGGACCTACAAATTAGTTGCTGGTATGTGGAGTCCTTGACGCATTTATATGCTCTGGAAG
GGATGCATTGCGGATTGGAATATCTTGCAAAGTTTATTTCTCAGTACTGGACTACATGCTGGCCATCGCA
GGAAGAAGGTCAGGAAATTCGTTACAGTAAATTGGTTCGTCTTGATATAGATTTATCAGAGTATCTGAAA
GCATATCCTCTTCTTGAGGATAAGGAAATCACACTTTCTGAATGGTATAAGGTGTTATCGTTTGAACATG
GAGCAAGTTTGTCAGAAGCTGGAAAAGAAAGATTAATAGAGAGCGAAGGTGATCACTCTGTTGAGTCCTT
CAAAAGAGCTGTAGGAAAATATAATCCCCGCAAGGTTAGTGAGCAACTTCTCCAGCTTTATGATCTACCT
GACAAAATTGATGAGATTGAATCTTCTTACTTCTTTCATACGCATGAAGATATACATCATATTTTCGCAA
AAACCAGACATATCATCAGTGAGATAACCGAGTTACTGAGTCGTTTTTTGCCGCAAGAAACACTGGATCA
CAGTTCAGTTTCTCAATTTCTAGGCAAACCCGATAGCAGAGACACAAGGACAGCACTTCCTGAGGAGAAA
AAGGAATTTTATTCTGCATTAACACCCTCAACAGATAAAGAGATGTCAAGGGAGAAAGCTATAGAGCAAC
TGGAGAAAATAGCTATTTTTTTCAGGCAATCTGAACCAACCAGTCCTGTTCCTTATCTTCTGGAGAGGGC
CATACGTTGGTCAACAATGACTATGTCAGAATGGCTTGAGGAACTACTTAAAGATAATGACTCTATGGAA
CAAATAAACCGTGTCTTAAAAGGATGA