SecReT6
Protein ID: 218696594
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3292
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3379980..3381962 [-]
Producthypothetical protein
NoteTssI
UniProt IDB7LFQ9
KEGG IDeck:EC55989_3292
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-36, Aligned region: 38..318
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 1.70E-21, Aligned region: 463..481
DUF2345 [PF10106], Evalue: 0.00028, Aligned region: 495..630
Protein Sequence: 660 a.a.     [Download]
>gi|218696594|ref|YP_002404261.1| hypothetical protein EC55989_3292 [Escherichia coli 55989]
MTRQRFISDDHYKFQSEHFIRLHGCDISLFPLEIKGKESISDVYSYEIKCFSRTDHNSLDKLHGTRLSCE
IGEQYNSLPARFIHGVVTKVIYNYDNSMQHTCIIILQPEIAELASGKRTRVWSNIKPSDIVSTILEDSLF
SPPQVILYKEQNLLEYKIQYQESDLDFINRILSEAGIYYFFVHNRDKHIMTLADDPASHPKASYDKLEHL
PCENLKESRHGYIREWSFTESLKCPSVTLSGYNESNVSEITIKSESKLTDVKPSKGVYEDIIPERKRELI
KKRSEALIASCDSELKIWSGKTDSWWLSCGECFSLDKQDYRITSLYLNAVNNDNEHAGLCYCDLCASDNK
SSLNFSREFKTPIIPGVLLARVVGPDSEEYYTDDNGRVKISFLWGEKSAAGTDKTSCWVRVSQVWSGEGF
GSQFIPRIGSEVLVSFIQGNPDYPVIVGTVYNGQNTSPFSLPENNCKSGFITRSVKNGKKGEGHQLVFDD
KEGEEKVIVTSSGDSLLTVKKDMISTINRSMSLTIAEGRNAEIKRGNDRLVLKEGDLHNDVHGNINIKVS
NGDYNLKVSGGSGSLITDKNLTLESTQSIKIKVGANEITISTSGIDIKAAKITIEGQVSAEVKAATLKFE
SQAISEVKGTMLTLQGSAMTQIKGGIVNIG
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3381962-3379980 Escherichia coli 55989 chromosome, complete genome
ATGACTAGGCAAAGATTTATATCTGACGATCATTATAAATTCCAGAGTGAACATTTTATCCGGTTGCACG
GCTGTGATATATCATTATTTCCACTTGAGATTAAAGGTAAAGAGTCAATATCTGATGTATATAGTTATGA
AATAAAATGCTTTAGTAGGACCGACCACAACTCTCTGGATAAGTTACACGGCACGCGTTTGAGTTGTGAG
ATCGGGGAACAATACAATTCGTTACCTGCGCGCTTCATTCATGGTGTGGTCACAAAAGTGATATATAATT
ATGATAACAGCATGCAACATACCTGCATTATTATCTTACAACCAGAGATAGCCGAATTGGCATCTGGTAA
AAGAACAAGAGTATGGTCAAATATAAAGCCATCAGATATTGTAAGCACAATTCTGGAAGACAGTTTATTT
AGTCCGCCACAAGTAATTTTATATAAAGAACAGAATTTGCTGGAGTATAAGATCCAGTACCAGGAGTCAG
ATCTTGACTTTATTAATAGAATTTTGTCTGAGGCGGGCATTTACTATTTCTTTGTTCATAATAGAGATAA
ACATATTATGACATTGGCAGATGATCCTGCATCTCATCCTAAAGCATCTTATGATAAACTGGAACACTTA
CCCTGTGAAAATCTGAAGGAATCGCGTCATGGCTATATCAGGGAATGGTCTTTCACAGAAAGTCTCAAAT
GTCCTTCTGTGACACTTTCAGGTTATAATGAGAGTAATGTCAGTGAAATTACTATAAAGTCAGAAAGTAA
ACTGACGGATGTAAAACCCAGTAAGGGAGTTTATGAAGATATTATCCCAGAGAGAAAGCGTGAGTTGATA
AAGAAACGTTCTGAAGCACTGATAGCATCATGTGACAGTGAACTCAAAATCTGGTCAGGAAAAACGGATT
CATGGTGGTTGTCATGCGGGGAGTGTTTCAGTCTGGACAAACAGGATTACAGAATTACTTCGTTATATCT
TAATGCTGTCAACAATGACAATGAACATGCTGGTTTGTGTTATTGTGATTTGTGTGCTTCAGATAATAAA
AGCTCACTTAATTTCAGCCGTGAATTTAAAACACCTATTATTCCCGGTGTTTTACTTGCCAGAGTGGTCG
GTCCTGACTCCGAAGAATATTATACAGATGATAATGGGCGTGTAAAAATCAGCTTTCTCTGGGGAGAAAA
GTCAGCGGCAGGTACAGATAAAACCTCCTGTTGGGTCCGTGTATCTCAGGTATGGTCCGGGGAGGGATTC
GGTAGTCAGTTTATTCCTCGCATTGGCAGTGAGGTTCTGGTTAGTTTTATACAGGGTAATCCTGACTATC
CAGTTATCGTTGGTACAGTGTATAATGGTCAGAATACATCGCCTTTTTCTCTTCCTGAGAATAATTGTAA
GTCTGGATTTATCACCCGTAGTGTTAAGAATGGTAAAAAAGGAGAAGGTCATCAACTGGTTTTTGATGAT
AAAGAAGGTGAGGAAAAAGTTATAGTGACTTCATCTGGTGATTCTCTCCTGACTGTAAAGAAGGATATGA
TCAGCACTATTAACCGCTCTATGTCGTTAACTATTGCTGAAGGGCGTAATGCTGAAATAAAAAGAGGGAA
TGACAGGCTTGTTCTTAAAGAAGGTGACCTACATAATGATGTACATGGTAATATTAATATAAAAGTTTCG
AACGGAGATTATAATCTTAAAGTGAGCGGGGGAAGTGGTAGTCTTATCACCGATAAGAATCTTACTCTTG
AATCAACACAGTCAATAAAAATAAAAGTGGGTGCAAATGAGATAACGATATCCACATCAGGTATAGATAT
AAAAGCCGCTAAAATTACTATAGAAGGGCAGGTATCGGCAGAGGTCAAAGCGGCCACACTTAAGTTTGAA
AGCCAGGCTATTTCTGAGGTAAAAGGCACCATGTTGACGCTTCAGGGCTCTGCAATGACACAGATAAAAG
GTGGAATCGTGAATATAGGATAA