SecReT6
Protein ID: 218696595
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3293
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3381975..3382934 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7LFR0
KEGG IDeck:EC55989_3293
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.70E-53, Aligned region: 16..305
Protein Sequence: 319 a.a.     [Download]
>gi|218696595|ref|YP_002404262.1| hypothetical protein EC55989_3293 [Escherichia coli 55989]
MADKSRKVNMALINNRSKFSFFNKVRVLLKNILKPDESVEDVVDEHFRFTSSLSLDAPDGQIENLYQDEK
DGKYHLTLFDNGLTGATGILPAAYTEWLIERKLRYNDDAPKAFMDMFDHRMYCLSYLAWQKMHLSGDENR
RDNNVLNNVLLSLGGITPQTVSVTGLAYVAFYSQPVRSLAGLEQLLSLIHQIRVSINPFRGTFENTEPSE
QGVLGNCLYTLGEGPVIGNVRWVVDSHFDVVLGPVDYRKAQELMPGKDSHYFIRQQIRSYIGDVLKFKIY
VKIYPGNNDNQLNINNKLGFNLSLGSETENYKERCFCIF
 
Nucleotide Sequence: 960 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3382934-3381975 Escherichia coli 55989 chromosome, complete genome
ATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTTGATTAATAACCGGAGTAAATTCAGCTTTTTCAATA
AAGTCCGTGTGTTATTGAAAAATATTCTGAAACCAGATGAAAGCGTTGAAGACGTTGTTGATGAACATTT
CAGATTTACATCAAGTCTGTCTTTAGATGCACCTGACGGTCAGATAGAGAACCTGTATCAGGATGAGAAG
GACGGAAAGTATCATCTCACATTATTCGATAATGGATTAACCGGGGCTACAGGGATTCTTCCTGCCGCAT
ATACAGAATGGCTGATTGAAAGGAAATTACGTTATAATGATGACGCTCCTAAGGCATTCATGGACATGTT
TGACCATAGAATGTATTGTCTTTCTTATCTCGCATGGCAAAAAATGCATCTGTCAGGAGATGAAAACAGA
AGGGATAATAATGTTCTTAACAATGTTCTTTTATCTTTAGGCGGGATCACTCCTCAGACAGTTAGTGTGA
CAGGTCTGGCATACGTTGCATTCTATTCACAACCAGTAAGATCCCTGGCCGGGCTTGAGCAGTTACTCTC
GTTAATACATCAAATCAGAGTGTCCATTAATCCTTTTCGTGGCACTTTTGAAAATACAGAACCCAGTGAG
CAGGGGGTTCTGGGGAATTGCCTCTATACTCTGGGGGAAGGTCCTGTCATAGGCAATGTTCGTTGGGTGG
TTGATTCACATTTTGATGTTGTATTGGGGCCTGTGGACTATAGAAAAGCACAGGAACTTATGCCGGGAAA
AGATTCCCACTATTTTATCAGACAACAAATAAGATCGTATATAGGTGATGTTCTTAAGTTCAAAATATAT
GTGAAAATCTATCCCGGTAACAATGATAATCAACTTAATATAAACAATAAGCTTGGTTTCAATCTTTCAC
TCGGTTCTGAAACAGAAAATTATAAAGAACGGTGCTTTTGTATATTTTGA