SecReT6
Protein ID: 218696596
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3294
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3382898..3384700 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7LFR1
KEGG IDeck:EC55989_3294
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.00E-138, Aligned region: 4..597
Protein Sequence: 600 a.a.     [Download]
>gi|218696596|ref|YP_002404263.1| hypothetical protein EC55989_3294 [Escherichia coli 55989]
MNKLLSYYQKELAFLRKQGIEFAKKYPKVARRLGYNQGGSEDPHVQRLTESFAFLSSKIHQRLDEDLPEL
MEALLRNLAPQFLYNYPSSCIVSFEPDRKSSGITSTYRVPSGTSLYSRYKYKTICQFRTVYPLTIVPATV
NKARIHYDNSSSLWKIELNLDVFDGANFSLDFVRFYLNGPATVTGIIYTLLCDEVDNIVLQRNNDVLYDI
SANISGAGFYESEVTLPQKGNVSYIHNLILDYFSFPERFNFIDIEFDSGIELCSGDSVRIEITLKSSAEK
YEPDRIERNVSERLFKVNCSPVVNLFEKKTEPLRLSDGQDEYQVNTDLYSRNEVLIWDINKVTLHRYEND
IVKQFPLKNLFGLEHSVIKQSCNIFWHSSCYRSSSERGNFEESVYIRLSDDGGAQSCIMTGDVLSIDAIC
TNGNIPSSINNGDPDGDFDCDIDIAQLRITALNRPSRMLPAMALKGMNWRIVSQLSLNFVLLSGTDGAMK
LREMLSIYNYNNNHSISIFIEWIKELQITPVSSRLPGIYPPVTARGIDITVTLSKDADMHPECFMFCSFL
DHFLGLHAPVNSFTRMITVIEHEEHTRRVWPIRAGKLTWL
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3384700-3382898 Escherichia coli 55989 chromosome, complete genome
ATGAATAAACTATTATCTTACTATCAGAAAGAACTCGCTTTTCTTAGAAAACAAGGTATTGAGTTTGCAA
AAAAATATCCAAAGGTAGCCCGGCGTCTTGGATACAATCAGGGGGGGTCTGAAGATCCACATGTTCAGAG
ATTAACGGAGTCTTTTGCTTTCTTAAGTTCAAAAATTCATCAGAGATTAGATGAAGATTTACCCGAGTTA
ATGGAAGCATTACTTCGTAATCTTGCTCCCCAATTTTTGTATAACTATCCTTCATCATGTATTGTATCAT
TTGAACCAGACAGAAAATCCAGTGGAATAACTTCAACTTATAGAGTTCCTTCTGGCACATCGCTATATTC
CAGATATAAATATAAAACCATCTGTCAGTTTCGGACGGTATATCCACTGACTATTGTCCCTGCAACGGTT
AATAAAGCAAGAATTCACTATGATAATTCGTCCTCCTTATGGAAAATTGAATTGAATTTAGACGTTTTCG
ACGGAGCTAATTTTTCTCTTGATTTTGTAAGATTTTATTTGAATGGTCCGGCAACGGTTACTGGTATAAT
ATATACATTATTGTGCGATGAGGTCGATAATATCGTTTTGCAGAGAAATAATGATGTGTTATATGATATC
AGTGCTAATATATCCGGTGCCGGATTTTATGAGAGTGAAGTAACACTTCCACAAAAAGGGAACGTTTCTT
ATATACATAACCTCATACTGGACTATTTTTCTTTTCCAGAACGATTTAACTTCATTGATATAGAATTTGA
CTCCGGAATCGAATTATGCTCAGGGGATTCTGTGAGAATAGAAATAACATTAAAAAGCAGTGCAGAAAAG
TATGAGCCAGACAGAATAGAAAGGAATGTTTCTGAAAGACTTTTTAAAGTAAACTGTTCTCCCGTTGTCA
ATCTCTTCGAGAAGAAAACTGAACCCCTACGATTATCTGATGGCCAGGATGAGTATCAGGTAAATACCGA
TTTATATTCACGTAATGAAGTCTTAATCTGGGATATAAATAAAGTGACATTGCACAGATATGAAAATGAT
ATAGTCAAGCAGTTTCCGTTAAAAAATTTATTTGGACTTGAACATTCTGTCATTAAACAATCGTGCAATA
TATTCTGGCATAGTTCATGTTATCGCTCGTCTTCTGAAAGAGGGAACTTTGAGGAAAGTGTATATATTCG
TCTGAGCGATGATGGCGGAGCCCAGTCATGTATCATGACTGGGGATGTCCTTTCAATTGATGCAATATGT
ACAAATGGTAATATTCCATCATCAATTAATAATGGTGATCCTGATGGTGATTTTGATTGTGATATAGATA
TTGCTCAGCTGCGAATAACTGCGCTGAACCGTCCATCAAGAATGTTGCCGGCTATGGCATTAAAAGGAAT
GAACTGGAGAATTGTTTCTCAGTTATCCCTTAATTTTGTGTTGCTCAGTGGTACTGATGGGGCAATGAAA
CTGAGAGAAATGCTATCCATATATAACTACAACAATAACCACTCAATATCAATTTTTATTGAATGGATTA
AAGAGTTACAAATCACACCAGTTTCATCCCGTTTACCCGGCATATATCCGCCTGTAACTGCTCGTGGAAT
TGATATTACCGTAACTCTTTCAAAGGATGCAGATATGCACCCTGAATGTTTCATGTTTTGCTCTTTCCTT
GATCACTTTCTTGGGCTACATGCCCCTGTCAATAGCTTTACTCGCATGATTACTGTCATTGAACATGAGG
AGCACACTCGTCGTGTATGGCCGATAAGAGCAGGAAAGTTAACATGGCTTTGA