SecReT6
Protein ID: 218696597
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3295
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3384693..3385115 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7LFR2
KEGG IDeck:EC55989_3295
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-06, Aligned region: 26..118
Protein Sequence: 140 a.a.     [Download]
>gi|218696597|ref|YP_002404264.1| hypothetical protein EC55989_3295 [Escherichia coli 55989]
MHSFLQFLRDDNPGSLEDHLNFVPSDDLKYELGMLLSSRPLYLETDELPFVSSSVLNYGIKSSVYVVSAG
EHSDSVNDEISSRILMMLQRYESRLEEPVVEYLSSDDNYSFFSVTALFFMDMVRLCIKWDKNSGEFSLDE
 
Nucleotide Sequence: 423 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3385115-3384693 Escherichia coli 55989 chromosome, complete genome
ATGCATTCGTTTCTTCAGTTCTTACGTGATGATAATCCGGGCTCTCTGGAAGATCATCTGAATTTTGTTC
CTTCAGATGATCTGAAATATGAGCTCGGGATGTTATTATCATCACGACCTTTATACCTTGAAACAGATGA
GCTGCCGTTTGTTAGTAGTTCTGTCCTGAACTATGGCATAAAGTCATCAGTATATGTAGTTTCTGCAGGT
GAACATAGTGATTCTGTTAATGATGAAATTTCTTCAAGAATATTGATGATGCTCCAGCGTTATGAGTCCC
GGCTGGAGGAACCAGTTGTTGAATATCTTTCCAGTGATGATAATTATTCTTTCTTTTCAGTTACAGCCCT
GTTCTTTATGGACATGGTAAGACTCTGTATTAAATGGGATAAGAACTCAGGAGAATTTTCACTGGATGAA
TAA