SecReT6
Protein ID: 218696599
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3297
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3385641..3387119 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7LFQ8
KEGG IDeck:EC55989_3297
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-177, Aligned region: 65..488
Protein Sequence: 492 a.a.     [Download]
>gi|218696599|ref|YP_002404266.1| hypothetical protein EC55989_3297 [Escherichia coli 55989]
MTVASTLGLNETQYATDDCLEEIINNTRAVRQDSEKTRFKLQINNFLAEVASGSLVINSDLIGSIEKRIA
DIDKLMSEQLSLIMHATEFQKIESAWTGLYKLVQASVTENVKYTVLHCTKKELLKDFKSASDFDQSVLFK
NIYESEYGTFGGTPYSAFVGDFYFDNTPQDIDLLEHISHVAASAHAPFLSAIAPGMLSMSSFSELPYPRD
LAKLFETTDYARWRSFRQTDDSRYVGLTLPQSLGRIPYGMKTIPAETFNFEEHISEDNSGKDYLWVNTAF
ELACRIVDAFEEYGWCAAIRGVEGGGLVKSLPAYNYVSHTGERLLQCPTEVAISDRREKELSDLGFIPLV
YCKGTDFAAFFAVQSVNKARLYNTDQANANAKLSSQLQYILATSRFAHYLKVIVRDKVGSFMSRTECQTY
LQNWIMQYVVASDNAGQETKARYPLREASVEVIEVPGSPGNYRAIAWIKPHFQLEGLSMSLRLVADLPSS
VS
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3387119-3385641 Escherichia coli 55989 chromosome, complete genome
ATGACAGTTGCATCAACATTAGGGCTGAATGAAACTCAGTATGCTACAGATGATTGTCTTGAAGAGATTA
TAAATAATACCAGAGCTGTGAGACAGGATTCTGAAAAGACCAGGTTTAAACTACAGATTAATAATTTCCT
TGCTGAAGTTGCCAGTGGTTCTTTGGTCATTAACAGCGATTTAATCGGTAGTATTGAAAAGCGGATTGCT
GATATTGATAAGTTGATGTCTGAGCAGCTTAGTCTGATTATGCATGCGACTGAATTTCAAAAAATAGAAT
CAGCATGGACGGGACTTTATAAGCTGGTTCAGGCCAGCGTTACTGAAAATGTAAAATACACGGTGTTACA
CTGTACTAAAAAGGAATTGCTCAAAGACTTCAAGTCAGCCTCAGATTTCGATCAGTCTGTCTTATTTAAG
AATATTTATGAAAGCGAGTATGGAACGTTCGGGGGAACACCGTATTCTGCTTTTGTTGGTGATTTCTATT
TTGATAATACACCGCAGGATATTGATTTGCTGGAGCATATTTCCCATGTTGCTGCCAGTGCTCATGCCCC
GTTTCTGAGTGCTATTGCTCCGGGTATGTTGTCCATGAGTTCATTTAGCGAATTACCCTACCCGCGTGAT
CTGGCAAAATTGTTTGAGACAACAGATTATGCCCGTTGGCGTAGTTTCAGGCAGACAGATGACAGTCGTT
ATGTGGGATTGACTTTGCCACAGTCTCTGGGGCGTATTCCATATGGCATGAAGACTATACCTGCCGAAAC
GTTTAATTTTGAAGAGCACATTAGTGAAGATAACTCAGGCAAAGACTATCTGTGGGTAAATACAGCTTTT
GAACTTGCCTGCCGGATAGTTGATGCTTTTGAGGAGTATGGCTGGTGTGCAGCAATTCGGGGCGTGGAAG
GTGGCGGTTTGGTTAAATCATTGCCGGCCTATAATTATGTATCCCATACAGGTGAGCGACTTTTACAATG
TCCGACGGAGGTTGCTATCTCAGACCGTCGGGAAAAAGAATTGTCAGATCTCGGTTTTATTCCTCTGGTT
TATTGTAAAGGTACTGATTTTGCGGCATTTTTCGCTGTTCAGTCGGTAAACAAAGCACGACTGTATAATA
CTGATCAGGCTAATGCGAATGCAAAATTATCCAGTCAGCTTCAGTATATATTAGCAACATCACGATTCGC
ACATTATCTTAAAGTGATTGTTCGTGACAAAGTTGGAAGCTTTATGTCGAGGACAGAATGTCAGACATAT
CTGCAAAACTGGATCATGCAATATGTTGTGGCATCAGATAACGCTGGTCAGGAGACAAAGGCTCGTTATC
CATTACGTGAGGCATCTGTTGAAGTTATTGAAGTCCCTGGAAGTCCGGGAAATTATCGTGCAATTGCATG
GATTAAACCTCATTTTCAGCTTGAGGGTTTAAGTATGTCATTGCGTCTTGTTGCTGATTTACCATCAAGT
GTAAGTTAA