SecReT6
Protein ID: 218696600
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3298
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3387122..3387598 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7LFR5
KEGG IDeck:EC55989_3298
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-45, Aligned region: 8..146
Protein Sequence: 158 a.a.     [Download]
>gi|218696600|ref|YP_002404267.1| hypothetical protein EC55989_3298 [Escherichia coli 55989]
MSNTQHKLDKTRPPRVQITYDVETGDAETAKELPLVIGVLGEYSSSEKPLRERKFISIDKDNFDEVMASM
SPTAHFMVDSVIPGNEGKLDVELRFSCKDDFSPDNVIQQVECLRKLSELRLHLCDLRNRAASNEKLKEKL
QELLVTTNGNPENDESKE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3387598-3387122 Escherichia coli 55989 chromosome, complete genome
ATGAGCAATACACAACATAAACTTGATAAAACCCGCCCCCCACGAGTACAGATAACGTATGATGTTGAAA
CCGGAGATGCTGAAACTGCGAAAGAGTTACCCCTTGTCATCGGGGTTTTGGGTGAGTACTCTTCGTCAGA
AAAACCATTGAGAGAACGAAAATTCATTAGTATAGATAAAGACAATTTTGATGAAGTTATGGCATCAATG
AGTCCGACTGCTCATTTTATGGTGGACAGTGTTATCCCGGGAAATGAAGGAAAACTGGATGTCGAACTGA
GGTTTAGTTGCAAAGATGATTTTTCTCCCGATAATGTGATTCAACAGGTTGAGTGTCTAAGAAAATTATC
GGAATTGAGGTTGCATCTTTGTGACCTACGAAACAGGGCTGCAAGTAATGAGAAACTGAAAGAAAAACTT
CAGGAATTGCTGGTGACTACTAATGGCAATCCTGAAAACGATGAAAGTAAGGAATAA