SecReT6
Protein ID: 218696619
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3319
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3402305..3402739 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7LFT4
KEGG IDeck:EC55989_3319
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.60E-19, Aligned region: 27..115
Protein Sequence: 144 a.a.     [Download]
>gi|218696619|ref|YP_002404286.1| hypothetical protein EC55989_3319 [Escherichia coli 55989]
MMPRPSLYEILYGNFTGGLELNQVGEEEQVILSVLDNMQRILNTRAGSLKHLPDYGLPDITTILQGMPGT
AHQLMRVLSDVLLKYEPRIKRVDVTMQEQTQPGELHYVIDAELKDAGLVRYGTTFIPEGRVLLRHLKQQR
YVQT
 
Nucleotide Sequence: 435 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3402739-3402305 Escherichia coli 55989 chromosome, complete genome
GTGATGCCGCGTCCTTCCCTTTATGAAATTCTCTATGGCAATTTCACTGGCGGGCTGGAGTTAAACCAGG
TCGGTGAGGAAGAGCAGGTTATTCTTTCGGTGCTCGATAACATGCAGCGTATTCTGAATACCCGTGCCGG
AAGCCTTAAGCATCTTCCGGATTATGGTCTGCCGGATATAACAACCATTCTGCAGGGAATGCCGGGGACG
GCGCATCAACTGATGCGCGTGCTTTCAGACGTTCTGCTGAAGTATGAGCCACGTATTAAGCGCGTCGACG
TGACGATGCAGGAACAGACTCAGCCTGGTGAGTTGCATTATGTCATTGATGCAGAACTTAAAGATGCCGG
GCTGGTTCGTTACGGAACAACATTTATACCGGAGGGCAGGGTGTTGTTGCGCCATCTGAAACAGCAGCGC
TACGTGCAGACGTGA