SecReT6
Protein ID: 218696620
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3320
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3402739..3403275 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7LFS8
KEGG IDeck:EC55989_3320
PDB ID3RX9
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.20E-37, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|218696620|ref|YP_002404287.1| hypothetical protein EC55989_3320 [Escherichia coli 55989]
MAIIAGKAGYGLIIALFSLSLSGCGLTQRVADGTVSATKSLFYRQIKTLHLDIRAREAINTSAAGIPLSV
VVRIYQLKDNRSFDSADYQALFTGDNEILAGDIIAQKDVWLQPGGSVAVDMPLDDAAKFTGVAAMFLEPD
QKKNTWRVVLGRDELEPDTPRLIEVSGNTLTLLPVKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3403275-3402739 Escherichia coli 55989 chromosome, complete genome
ATGGCGATTATCGCTGGTAAGGCTGGTTACGGTCTGATTATTGCGTTGTTTTCCCTGTCGTTATCAGGAT
GCGGTCTGACGCAAAGAGTGGCAGACGGTACGGTATCTGCCACGAAATCCCTGTTTTACCGACAGATAAA
AACACTTCACCTGGATATTCGTGCCAGGGAGGCCATTAACACCAGTGCTGCCGGTATTCCCCTGTCGGTT
GTGGTGCGGATTTATCAGCTTAAAGACAACCGGAGTTTTGACAGTGCGGATTATCAGGCGCTTTTTACAG
GGGACAATGAAATTCTGGCAGGCGATATCATTGCACAGAAAGATGTATGGCTGCAGCCAGGTGGTTCAGT
AGCCGTGGATATGCCTCTGGATGATGCGGCGAAATTTACCGGTGTGGCAGCAATGTTTCTGGAGCCTGAC
CAGAAGAAAAATACCTGGCGGGTGGTGCTGGGCCGGGATGAGCTTGAGCCGGACACGCCCCGTCTTATTG
AAGTATCCGGTAACACCCTGACCCTGTTACCGGTGAAGGATAAATAG