SecReT6
Protein ID: 218696621
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3321
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3403256..3404356 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7LFT6
KEGG IDeck:EC55989_3321
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.00E-78, Aligned region: 22..326
Protein Sequence: 366 a.a.     [Download]
>gi|218696621|ref|YP_002404288.1| hypothetical protein EC55989_3321 [Escherichia coli 55989]
MHPVERKSQSAPARLITRYRKQLPYINFYRFCQLLEQSQPDQPPIGSGWQARQEAVRFCPYPGMGFPASE
IKDAVIPEESHLPPIVHVTFMGLYGVTSPLPAHYISDIAQQREGHEAAADFLDIFSHRLITQYYRIWRKY
SYPATFEAGGQDKTSQYLLGLARLGIPGCAQNIATPVSRFLALLPLMLLPGRTAEGLTSLVTLLAPGTQA
RVWHHDRRRIPLKTPLTMRVHHPVSLKSRPVMGDHATDVNGQVLLQLSTQTGSEVQGWLPGGHLYSDLLA
LLHVYLGSRLDVRLQLCVERSLLPDARLSCRPAAGSPQLGRTAVMRTQAKIATSAARVMTISLGRYQRVQ
EHYQRKETQENGDYRW
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3404356-3403256 Escherichia coli 55989 chromosome, complete genome
ATGCATCCGGTGGAAAGAAAATCACAATCCGCGCCTGCCCGGTTAATTACCCGTTACCGGAAACAGCTTC
CGTATATTAATTTTTACCGCTTCTGTCAGTTGCTGGAACAAAGCCAGCCAGACCAGCCTCCCATTGGCAG
TGGCTGGCAGGCCCGTCAGGAAGCGGTTCGCTTTTGTCCATACCCGGGAATGGGGTTTCCTGCGAGTGAA
ATAAAAGACGCTGTAATTCCTGAAGAATCCCATCTGCCACCCATTGTACATGTGACGTTTATGGGACTTT
ACGGGGTCACGTCTCCGTTGCCGGCACACTATATCAGTGATATTGCACAGCAGCGGGAAGGCCATGAGGC
CGCAGCGGATTTTCTCGATATATTCAGTCATCGTCTGATCACCCAGTATTACCGTATCTGGCGTAAATAT
TCGTACCCGGCCACCTTTGAGGCGGGAGGACAGGATAAAACATCCCAGTATCTGCTCGGTCTGGCCAGAC
TGGGGATCCCCGGATGTGCACAGAATATTGCCACGCCGGTATCGCGTTTTCTGGCGTTATTGCCCCTGAT
GTTGTTACCCGGAAGAACAGCTGAAGGGCTGACATCACTGGTAACGCTGCTGGCTCCCGGAACACAGGCC
CGTGTCTGGCATCATGACCGACGACGGATCCCGCTGAAAACACCGCTGACCATGCGTGTTCATCACCCGG
TCAGTCTGAAGAGTCGCCCGGTGATGGGCGATCATGCCACGGATGTGAACGGACAGGTGTTATTACAGCT
TTCAACACAGACGGGCAGCGAGGTACAGGGCTGGTTACCAGGCGGGCATCTGTATTCTGATTTGTTGGCG
TTGTTGCATGTTTATCTGGGAAGCCGTCTGGATGTACGTCTGCAACTTTGTGTTGAGCGTTCACTGTTAC
CGGATGCCCGGCTCAGTTGCCGACCGGCAGCCGGTAGTCCGCAACTGGGGCGCACGGCAGTAATGAGAAC
ACAGGCAAAGATAGCGACTTCAGCGGCACGCGTCATGACCATCAGTCTGGGGCGTTATCAGCGGGTTCAG
GAACATTATCAACGTAAGGAGACTCAGGAAAATGGCGATTATCGCTGGTAA