SecReT6
Protein ID: 218696622
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3322
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3404311..3406074 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7LFT7
KEGG IDeck:EC55989_3322
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-179, Aligned region: 6..581
Protein Sequence: 587 a.a.     [Download]
>gi|218696622|ref|YP_002404289.1| hypothetical protein EC55989_3322 [Escherichia coli 55989]
MDDLTLRYFDAEMRYLREAGKAFAQAHPDRAAMLDLDKAGTPDPCVERLFEGFAFSMGRLRQKIDDDLPE
LTESLVSMLWPHYLRTIPSLSVVALTPRLSVMKMAETVPAGLEVTSRPVGPGNTVCRYRTTRAIPLNPLA
VEKVVMTTEPDGRSVLKIGFACSELADWSQVDLHRLSLYLAAEAPVSSTLHLMMTKRLAALYLRLPGNDE
RIRIDGWFSPGGFAEEDRLWPKGDSAFSGYQLLLEYFTFREKFMFVHLNGLENVSLPAGISGFDLEVVLS
QPWPADLPVTDDALCLHCVPVINLFTLEADPLIINGLESEYLLRPKRLQDGYTEIYSVDAVTGSGRTGSA
EYVPFTSFRHRGGMLRHDAPERYYHTRVKRGVTGMYDTWLILGGQRWEADRMPERETLSLRITGTNGQLP
RRALQSTLLDRCEQVLQAPVSVRNLCKPTLPVYPPTEDRFHWRVMSHLGTGFLNMLSSAEVLRGTLALYN
WRDDELNHRRLDAILAVQHHRIQRFEKGFLLRGLDVEVTLDGNGFAGEGDIHLFGEMLNRFLALYADMNQ
FNQLTLIVQPEGKCIRWKENHNPRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3406074-3404311 Escherichia coli 55989 chromosome, complete genome
ATGGACGATTTAACCCTGCGTTATTTTGACGCTGAAATGCGTTATCTGCGTGAAGCCGGAAAGGCGTTTG
CACAGGCTCATCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCGGGTACGCCTGATCCCTGCGTGGA
ACGCCTGTTTGAAGGTTTCGCCTTTTCCATGGGACGACTGCGCCAGAAAATCGACGATGATTTGCCGGAG
CTTACTGAAAGTCTGGTCAGTATGCTCTGGCCTCATTACCTGCGTACTATCCCGTCCCTGTCGGTGGTGG
CACTGACTCCCCGGTTATCCGTCATGAAAATGGCTGAAACCGTACCAGCCGGACTGGAAGTGACTTCCCG
CCCTGTTGGCCCCGGAAATACAGTCTGTCGTTACCGTACCACCCGGGCCATACCACTGAATCCACTGGCA
GTGGAGAAGGTTGTTATGACGACGGAGCCGGACGGGCGTTCAGTGTTGAAAATAGGTTTTGCCTGCAGTG
AACTGGCTGACTGGTCTCAGGTCGATTTGCATCGTCTGAGCCTGTATCTGGCAGCAGAAGCCCCGGTCAG
CAGCACCCTTCATCTGATGATGACAAAGCGTCTGGCTGCGCTGTATCTGAGGCTGCCGGGAAATGATGAG
CGGATCCGCATTGACGGATGGTTTTCACCCGGTGGTTTTGCAGAAGAAGATCGGCTGTGGCCGAAAGGTG
ACAGTGCTTTCAGTGGGTATCAGTTATTGCTGGAATATTTCACCTTTCGGGAAAAGTTTATGTTTGTTCA
TCTGAACGGACTGGAGAATGTTTCTCTGCCGGCAGGTATTTCCGGATTCGATCTTGAGGTGGTGCTGAGT
CAGCCCTGGCCAGCAGATTTACCTGTGACAGACGATGCCCTGTGTCTGCATTGTGTGCCGGTGATTAACC
TTTTTACGCTTGAAGCCGATCCACTCATCATCAATGGGCTGGAGAGCGAATACCTGCTGCGCCCGAAGCG
TCTGCAGGATGGGTATACGGAGATATATTCAGTGGATGCGGTGACGGGCTCCGGGCGGACCGGCAGTGCA
GAGTACGTGCCTTTTACCAGCTTCCGTCACCGTGGGGGAATGCTGCGCCATGATGCACCCGAACGTTATT
ATCATACCCGGGTGAAGCGGGGTGTCACGGGGATGTATGACACATGGCTTATCCTTGGCGGTCAGCGGTG
GGAGGCGGATCGGATGCCGGAGCGGGAAACGCTTTCATTACGTATTACAGGTACCAATGGTCAGCTTCCC
CGTCGTGCGTTGCAGAGTACGCTGCTTGATCGGTGTGAACAGGTACTGCAGGCCCCGGTCAGTGTACGTA
ATCTTTGTAAACCCACGCTACCGGTTTATCCGCCGACAGAAGATCGTTTTCACTGGCGGGTGATGAGTCA
TCTGGGGACAGGATTTCTTAACATGCTGAGCAGTGCGGAAGTGCTGCGTGGCACGCTGGCGCTTTATAAC
TGGCGGGACGATGAACTTAATCACCGTCGGCTTGATGCCATTCTGGCTGTACAGCATCATCGTATTCAGC
GTTTTGAAAAGGGTTTTCTGCTCCGGGGGCTTGATGTGGAGGTAACTCTTGATGGCAACGGGTTTGCCGG
AGAGGGAGATATTCACCTGTTTGGCGAAATGCTCAACCGTTTCCTGGCCCTGTACGCCGATATGAATCAG
TTCAATCAGCTCACACTGATTGTTCAGCCTGAAGGAAAATGCATCCGGTGGAAAGAAAATCACAATCCGC
GCCTGCCCGGTTAA