SecReT6
Protein ID: 218696624
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3324
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3406776..3408374 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7LFT5
KEGG IDeck:EC55989_3324
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-24, Aligned region: 70..126
Protein Sequence: 532 a.a.     [Download]
>gi|218696624|ref|YP_002404291.1| hypothetical protein EC55989_3324 [Escherichia coli 55989]
MASIHSLLSACQTTPRDVAEPAQVRIALWDKWLAPVTPDNPAGDDAGYDDDFQQMREEVNKLSGADAGIV
SQLAEKLLTTRTKDIRVATWYIWARLRQDGEKGLADGLELLTGLLQRFGEHLHPQRSRARKAALEWLCSA
RILDSLSLYPEVVKADTLRIAGALWLAEQTFTDEASAPVLNGLYQALENRLMKAGGVDAVVPQEAAAPAP
TVTSGSVMALSAITSGQELLSQARVLAKYLRDQPEGWLAAHRLMKSVRHDTLHQLPPLSADGRTRIAPPG
PDRRASLKRLYLQQNWLSLLEQCDDMFARGASHLWLDLQWYIHQALLQTGKENYAAIIQYDLKGLLLRLP
GLETLAFNDGMPFADDVTLSWIQQQVMECGERWAEEPSVTITAAPGDNDILSLEPEALQIADNEGTEAAL
SWLQARPGIQSDRSNWLLRLLMARVAEQTGKNDLALHLLAELDERATRLTLSQWEPELVFEVKARRLKLL
RMKSAKTESDRVRLQPDMEHLLAGLIAIDAARAAVLCNSGSS
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3408374-3406776 Escherichia coli 55989 chromosome, complete genome
ATGGCTTCCATTCATTCGCTCCTCAGTGCATGCCAGACGACACCCCGGGATGTGGCTGAACCGGCTCAGG
TGCGTATTGCGCTGTGGGATAAATGGCTTGCTCCCGTGACGCCAGATAATCCCGCAGGTGATGATGCGGG
GTACGATGATGATTTTCAGCAGATGCGTGAAGAGGTCAATAAACTCTCCGGAGCCGATGCCGGAATTGTC
AGCCAGCTTGCAGAAAAATTACTGACCACCAGAACCAAAGATATCCGGGTGGCGACCTGGTATATCTGGG
CCCGTCTGCGGCAGGATGGTGAAAAAGGTCTGGCCGACGGTCTGGAGCTGCTGACCGGTTTGTTGCAGCG
TTTTGGAGAGCACCTGCATCCACAACGGTCACGGGCCAGGAAGGCGGCGCTGGAGTGGTTATGCAGCGCC
CGCATACTGGACAGTCTGTCTCTGTATCCGGAGGTGGTGAAGGCGGATACCCTGCGCATTGCCGGGGCGC
TGTGGCTGGCAGAACAGACCTTTACGGATGAGGCTTCCGCCCCGGTGCTGAACGGGTTATATCAGGCACT
TGAAAATCGCCTGATGAAGGCCGGTGGTGTTGATGCAGTGGTGCCTCAGGAGGCTGCCGCGCCGGCACCG
ACGGTAACATCCGGCAGCGTCATGGCATTATCTGCCATCACCTCCGGACAGGAACTGCTGTCACAGGCCC
GTGTTCTGGCAAAATATCTGCGTGACCAGCCTGAGGGCTGGCTGGCGGCTCATCGACTGATGAAAAGCGT
CCGGCATGACACGCTGCATCAGTTACCGCCGTTATCTGCTGATGGACGGACCCGTATTGCCCCACCGGGG
CCGGACCGGCGTGCGTCACTGAAACGGTTGTATCTGCAGCAGAACTGGTTGTCACTGCTTGAACAGTGTG
ACGATATGTTTGCCCGGGGAGCCAGTCATCTGTGGCTGGACCTGCAGTGGTATATTCATCAGGCGCTGTT
GCAGACCGGAAAAGAAAATTATGCTGCCATTATTCAGTATGACCTGAAAGGATTGCTTCTGCGCCTGCCG
GGGCTTGAGACACTGGCTTTTAACGACGGCATGCCGTTTGCCGATGACGTGACGCTGAGCTGGATACAGC
AGCAGGTGATGGAGTGTGGTGAACGCTGGGCGGAAGAACCTTCTGTAACGATAACGGCAGCTCCCGGAGA
TAACGACATTTTATCTCTTGAGCCGGAAGCCCTGCAGATTGCGGATAATGAAGGAACAGAAGCCGCTTTA
AGCTGGTTACAGGCACGTCCCGGTATTCAGTCTGACCGCAGCAACTGGCTACTGCGCCTGTTGATGGCCC
GTGTTGCCGAACAGACAGGAAAAAATGACCTTGCCCTGCACCTGCTTGCGGAGCTGGATGAACGTGCAAC
CCGGCTGACCCTGTCACAATGGGAACCTGAACTGGTATTTGAGGTAAAAGCCCGCCGCCTGAAACTGTTG
CGTATGAAGTCCGCAAAAACTGAAAGTGACAGGGTGCGTCTGCAGCCTGATATGGAACATCTTCTTGCCG
GGCTCATCGCCATTGATGCTGCCAGAGCTGCTGTGTTGTGCAATTCGGGAAGTTCATGA