SecReT6
Protein ID: 218696631
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3331
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3416403..3418928 [-]
Producthypothetical protein
NoteTssI
UniProt IDB7LG62
KEGG IDeck:EC55989_3331
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.30E-61, Aligned region: 39..360
Phage_GPD [PF05954], Evalue: 9.30E-61, Aligned region: 628..671
DUF2345 [PF10106], Evalue: 6.70E-48, Aligned region: 612..765
T6SS_Vgr [PF13296], Evalue: 1.00E-35, Aligned region: 492..598
Phage_base_V [PF04717], Evalue: 8.90E-16, Aligned region: 392..486
Sarcoglycan_1 [PF04790], Evalue: 0.00036, Aligned region: 676..727
Sarcoglycan_1 [PF04790], Evalue: 0.00036, Aligned region: 733..773
Protein Sequence: 841 a.a.     [Download]
>gi|218696631|ref|YP_002404298.1| hypothetical protein EC55989_3331 [Escherichia coli 55989]
MNLTDSLQNVLSGVGTLNRYRLDIPSCPSSLDVEDFSGTEGISKIYRYDIIFTSTDRYPDAAWFLRKSAT
LIMGTGLLESLTEQKKVHGVITDFRRISGSEDQAQYRITLKPFISLLDKQFRTHRFFVNKSVPEVVEQIL
TEHGLKGWEYEFSLKRTYPKREQINQYQESDLRFIQRLLAEVGIFYFFTLHPDAQTEVIHFGDVQAALIF
DKTLPVNSPSGMSDSGTDSVWALNVEHRVVESRVITNDYNHREAQNILMSVPADMTRGEGYDTSYGEVYH
YRPRHTERGDKIDPAPETANFWARLDHERFLAEQTRITGKSTDASLLPAQVLTITDSTPPVLPAPLQEPV
LLTQLLFTGSRKSALQVMLSAVPYSEIVCWRPPLLTRPKITGTMTARVTSAKEGDIYAWQDASGMYRVKF
DADRDDKNPGQESMPVRLAKPYSGDAYGFHFPLIQGTEVAIAFEEGDPDRPYIAHALHDSRHVDHVTDKN
GTRNVIRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVDASRELRGEGAELRTDDWISIRGGKGI
FISADMQPQAQGKMLDMDEAIRQLEQALSLARSMAKAATAANATQGDISCQQRLNASLTDLTAPGMLLHA
PDGIGMVSARALRIASGSESVGIMSGDNTDITAGQSFTVVAEGAVSLLSRNQGMQLLAAKGRVNIQAQSD
DLSMSSQQNLDIQSSEGKVTVSANQELILACGGAYIKLSGGNIELGCPGQILLKSTNMQKMGPTSLDIAS
VEMPRGFGGGFILTDEAGVPQPSTPYRLTTAEGDILQGITDENGKTAPVNTSIPSVVKVEFGKVKIHGET
E
 
Nucleotide Sequence: 2526 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3418928-3416403 Escherichia coli 55989 chromosome, complete genome
ATGAATCTCACTGACTCCCTGCAAAATGTTTTATCCGGGGTGGGAACCCTGAACCGCTACAGACTGGATA
TACCTTCCTGCCCGTCATCGCTGGATGTTGAAGATTTCAGCGGAACTGAAGGCATAAGTAAGATTTACCG
GTATGACATCATTTTTACCAGTACGGACAGGTATCCTGATGCTGCCTGGTTCCTGCGTAAATCCGCAACC
CTGATAATGGGAACCGGATTACTGGAAAGCCTGACTGAACAGAAAAAAGTGCACGGTGTTATTACTGATT
TCAGACGTATTTCTGGCTCTGAGGACCAGGCACAATACCGGATCACACTTAAACCTTTCATTTCCCTGCT
GGATAAACAGTTCCGTACACACCGTTTTTTCGTTAATAAATCAGTGCCTGAGGTGGTGGAGCAAATCCTG
ACGGAACACGGGCTGAAAGGCTGGGAGTATGAGTTCAGCCTCAAAAGGACATATCCGAAGCGCGAACAGA
TTAACCAGTATCAGGAAAGCGATCTGAGATTTATCCAGCGCCTGCTGGCAGAAGTGGGCATTTTTTACTT
CTTTACGTTGCACCCGGATGCGCAGACAGAGGTGATCCACTTCGGTGACGTCCAGGCGGCGTTGATATTT
GATAAAACACTGCCCGTTAACAGCCCGTCCGGTATGAGTGACAGTGGCACAGACTCAGTATGGGCATTGA
ATGTGGAGCACCGGGTGGTGGAAAGCCGTGTTATCACGAACGACTATAACCACCGCGAGGCCCAGAACAT
ACTGATGTCCGTACCGGCGGACATGACCCGTGGAGAAGGTTACGACACCAGTTATGGCGAGGTTTATCAT
TACCGGCCACGCCATACAGAAAGGGGCGATAAAATTGACCCTGCGCCGGAGACGGCTAACTTCTGGGCCC
GGCTCGATCACGAGCGTTTTCTGGCTGAGCAAACACGTATCACAGGTAAAAGCACCGATGCCAGTCTGTT
ACCGGCACAGGTGCTGACTATTACTGACAGTACTCCACCAGTGTTGCCTGCACCGTTACAGGAGCCGGTT
CTGCTCACGCAGCTTCTGTTCACCGGTAGCCGGAAATCTGCGCTACAGGTGATGCTGAGTGCTGTTCCTT
ACAGCGAGATTGTCTGCTGGCGACCACCGTTACTTACTCGTCCGAAAATCACCGGGACCATGACGGCCCG
TGTGACCAGTGCAAAAGAAGGGGATATCTACGCCTGGCAGGATGCTTCAGGCATGTACCGGGTGAAATTT
GATGCTGACCGTGATGATAAAAATCCGGGACAGGAAAGTATGCCGGTACGTCTGGCCAAACCCTACAGTG
GTGATGCTTATGGTTTTCATTTTCCGCTGATTCAGGGAACGGAAGTGGCCATTGCTTTTGAGGAAGGTGA
TCCGGATCGTCCCTATATAGCGCATGCCCTGCATGATTCACGTCATGTTGATCACGTTACCGATAAGAAC
GGTACGCGCAATGTTATCCGTACGCCGGCAAATAACAAGTTGCGGATGGAGGACAAACGCGGTGAGGAGC
ATATCAAGCTCAGTACCGAGTATGGCGGTAAGACACAACTTAATCTTGGCCATAACGTTGATGCCTCCCG
GGAACTCAGGGGAGAAGGCGCTGAGCTGAGGACTGATGACTGGATAAGTATCCGGGGAGGAAAAGGAATA
TTTATCAGTGCAGATATGCAGCCTCAGGCACAAGGAAAGATGCTGGATATGGATGAAGCTATCCGCCAAT
TGGAGCAGGCATTATCTCTGGCCCGAAGTATGGCGAAGGCCGCAACTGCTGCAAATGCTACTCAGGGAGA
TATAAGTTGTCAGCAACGGTTGAATGCATCACTAACAGATCTCACTGCGCCGGGAATGCTGTTGCATGCT
CCTGATGGGATTGGCATGGTTAGTGCGCGGGCGTTACGAATTGCTTCAGGTAGTGAAAGCGTGGGCATAA
TGTCGGGAGATAACACTGATATTACTGCCGGGCAGTCATTTACAGTTGTAGCAGAAGGTGCTGTTAGCCT
GTTGAGCAGAAACCAGGGGATGCAACTGTTAGCAGCAAAAGGGCGGGTAAATATTCAGGCTCAAAGTGAC
GATTTGTCAATGAGTTCCCAACAGAATCTTGATATTCAAAGTTCTGAGGGCAAAGTGACTGTTTCTGCTA
ATCAGGAACTGATACTGGCATGTGGTGGAGCTTATATCAAACTAAGCGGTGGAAATATTGAGCTGGGATG
CCCGGGACAGATTCTGTTAAAAAGCACGAATATGCAGAAGATGGGACCAACAAGTCTTGATATTGCGTCT
GTTGAAATGCCGCGAGGGTTTGGGGGCGGTTTTATTCTTACCGATGAAGCGGGAGTGCCGCAACCTTCGA
CGCCTTATCGATTAACAACGGCTGAAGGTGATATTCTACAGGGGATCACCGATGAAAATGGTAAAACAGC
GCCAGTCAACACCTCCATTCCGTCAGTAGTAAAAGTTGAGTTTGGGAAGGTAAAAATTCATGGAGAAACA
GAATGA