SecReT6
Protein ID: 218696633
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3334
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3420014..3422680 [-]
Productchaperone clpB
NoteTssH
UniProt IDB7LG66
KEGG IDeck:EC55989_3334
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-41, Aligned region: 242..261
AAA_2 [PF07724], Evalue: 3.00E-41, Aligned region: 618..781
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 244..357
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 621..744
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 769..786
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 97..114
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 244..266
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 323..374
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 620..741
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 389..412
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 787..862
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 221..263
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 289..322
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 525..525
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 591..644
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 684..715
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 758..864
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 243..334
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 366..413
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 618..659
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 744..772
IstB_IS21 [PF01695], Evalue: 4.50E-07, Aligned region: 238..303
IstB_IS21 [PF01695], Evalue: 4.50E-07, Aligned region: 617..638
AAA_25 [PF13481], Evalue: 1.30E-06, Aligned region: 243..268
AAA_25 [PF13481], Evalue: 1.30E-06, Aligned region: 298..332
AAA_25 [PF13481], Evalue: 1.30E-06, Aligned region: 369..408
AAA_25 [PF13481], Evalue: 1.30E-06, Aligned region: 615..649
Arch_ATPase [PF01637], Evalue: 3.20E-06, Aligned region: 223..258
Arch_ATPase [PF01637], Evalue: 3.20E-06, Aligned region: 296..394
Arch_ATPase [PF01637], Evalue: 3.20E-06, Aligned region: 614..634
Arch_ATPase [PF01637], Evalue: 3.20E-06, Aligned region: 689..707
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 238..263
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 611..660
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 244..324
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 619..638
NACHT [PF05729], Evalue: 4.20E-05, Aligned region: 742..766
AAA_19 [PF13245], Evalue: 4.50E-05, Aligned region: 241..271
AAA_19 [PF13245], Evalue: 4.50E-05, Aligned region: 616..638
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 244..345
AAA_14 [PF13173], Evalue: 7.40E-05, Aligned region: 618..711
Sigma54_activat [PF00158], Evalue: 9.70E-05, Aligned region: 229..258
Sigma54_activat [PF00158], Evalue: 9.70E-05, Aligned region: 618..738
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 244..270
AAA_17 [PF13207], Evalue: 0.00013, Aligned region: 619..655
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 25..54
Clp_N [PF02861], Evalue: 0.00017, Aligned region: 108..125
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 238..260
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 618..646
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 244..264
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 621..640
DUF258 [PF03193], Evalue: 0.0029, Aligned region: 232..261
DUF258 [PF03193], Evalue: 0.0029, Aligned region: 618..632
AAA_28 [PF13521], Evalue: 0.0045, Aligned region: 244..319
AAA_28 [PF13521], Evalue: 0.0045, Aligned region: 620..639
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 244..265
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 618..650
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 245..265
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 621..641
RNA_helicase [PF00910], Evalue: 0.0087, Aligned region: 718..739
Protein Sequence: 888 a.a.     [Download]
>gi|218696633|ref|YP_002404300.1| chaperone clpB [Escherichia coli 55989]
MNNMENSAALLRRLNHYCARALEGAASLCQTRAHAEITPEHWLLKLLEQGEGDLTVLGRRYDWDMDAIWQ
SLLGWLDNQPRSVRSRPQLAQSLNALLKQAWMVASLQGEEHIRSVHLLGALTENPHLVRCDGLWPLLTLS
QSQLQRLSPLLDAQPDECPETLQDAEPVLPQGDSVTFIGRPVGADTAGIPSGDLPPVLQGALDKFTRDIT
ASAREGKIDPVSGRDTEIRQMVDILSRRRKNNPILVGDPGVGKTALVEGLALRIVEGNVPESLRPVTLRT
LDLGLLQAGAGVKGEFEQRLKNVIDAVQLSPAPVLLFIDEAHTLIGAGNQAGGADAANLLKPALARGELR
TIAATTWSEYKQYLERDAALERRFQMVKVDEPDDETACLMLRSLKSRYAEHHNVHITDEAVRAAVTLSRR
YLTERQLPDKAVDLLDTAAARVRMSLDTVPEQLTRIRSQLASLGMEKQALLEDIAVGHQNHGERLSAIEQ
EENVLMTARDDLEQQYARECELTGELLESRSDISRQSETHHLQQALHDIQQNQPLLSVDVDVRTVAGVVA
DWTGVPLSSLMKDEQTELLHLEKDIGRRVVGQDVALESIAQRLRAAKTGLTSGNGPQEVFLLVGPSGVGK
TETALALADVMYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEK
AHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDLLMQQLSEKPETTESELHELIRPLLRDH
FQPALLARFQTVIYRPLTPSAMRTIVEMKLAQVCERLHCHYGLSTSVDERVYDALTSACLLPDTGARNVE
SLLNQQLLPVLSRQLLSHMAAKQKPQALALAWSDEDGMVIELRQECAL
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3422680-3420014 Escherichia coli 55989 chromosome, complete genome
GTGAATAACATGGAAAATTCGGCAGCCCTGTTACGTCGTCTTAATCATTACTGTGCCCGTGCACTGGAAG
GCGCAGCCTCCCTTTGCCAGACCCGGGCCCATGCGGAAATCACCCCGGAGCACTGGTTACTGAAACTGCT
GGAGCAGGGGGAAGGAGACCTTACCGTGCTGGGCAGGCGTTATGACTGGGATATGGACGCGATATGGCAG
TCGCTGCTCGGCTGGCTGGATAACCAGCCCCGTAGCGTACGCAGTCGCCCGCAGCTTGCGCAGTCCCTGA
ATGCTCTGCTGAAACAGGCCTGGATGGTGGCCTCATTACAGGGAGAAGAACATATCCGCAGCGTGCATCT
GCTGGGTGCCCTGACGGAAAATCCGCACCTGGTTCGCTGTGACGGGCTGTGGCCTCTGCTGACACTGAGT
CAGAGCCAGTTGCAGCGTCTGTCCCCGCTGCTGGATGCGCAGCCTGATGAGTGTCCGGAGACGTTACAGG
ATGCAGAGCCTGTGCTGCCTCAGGGAGACAGTGTGACCTTTATCGGGCGCCCTGTCGGTGCGGATACGGC
AGGTATACCGTCAGGTGACCTGCCGCCGGTGTTACAGGGTGCGCTGGATAAATTCACCCGGGACATCACG
GCCAGCGCGAGAGAGGGGAAAATTGACCCGGTATCGGGACGCGATACGGAAATCCGTCAGATGGTGGATA
TTCTCTCCCGCCGTCGCAAGAATAACCCGATTCTGGTGGGGGACCCCGGTGTGGGGAAAACGGCTCTGGT
GGAAGGGCTCGCCCTGCGTATTGTGGAAGGTAACGTACCAGAATCTCTCAGACCCGTCACCCTGCGCACC
CTTGACCTCGGCCTGCTGCAGGCCGGTGCCGGCGTGAAAGGTGAATTTGAACAGCGTCTGAAAAACGTGA
TTGATGCCGTGCAGCTGTCACCGGCTCCTGTACTGCTGTTTATAGATGAAGCCCATACCCTTATCGGTGC
CGGTAATCAGGCCGGTGGCGCGGATGCGGCCAACCTGCTGAAGCCTGCGCTGGCGCGAGGCGAACTGCGC
ACCATTGCTGCCACCACCTGGTCTGAGTACAAACAATACCTGGAACGTGACGCGGCTCTGGAGCGGCGTT
TTCAGATGGTCAAAGTGGACGAGCCGGATGATGAGACGGCCTGTCTGATGCTGCGCTCCCTGAAATCCCG
TTATGCGGAACATCATAACGTGCATATCACCGATGAGGCAGTACGTGCTGCCGTCACACTCTCGCGCCGT
TATCTGACAGAACGTCAGTTACCGGACAAGGCCGTTGACCTGCTTGATACTGCTGCTGCCCGTGTGCGGA
TGAGCCTCGACACGGTGCCGGAACAGCTGACCCGAATCCGTTCACAGCTCGCTTCCCTCGGTATGGAAAA
ACAGGCACTGCTGGAAGATATTGCCGTTGGTCATCAGAATCACGGCGAACGCCTGTCTGCCATTGAGCAG
GAAGAGAACGTGCTGATGACAGCACGTGATGACCTGGAGCAGCAGTACGCCCGTGAGTGCGAACTCACCG
GTGAGTTACTTGAAAGCCGCAGCGATATTTCCCGCCAGAGTGAGACACATCACCTGCAGCAGGCACTGCA
CGACATTCAGCAGAATCAGCCCCTGCTCAGTGTGGATGTTGACGTACGCACCGTTGCCGGTGTGGTCGCG
GACTGGACCGGAGTGCCGTTATCCTCACTGATGAAGGATGAACAGACGGAACTGCTGCATCTGGAAAAGG
ATATCGGCAGACGGGTGGTCGGACAGGACGTGGCACTGGAATCCATTGCACAGCGTCTGCGTGCGGCGAA
AACGGGTCTGACATCCGGTAACGGCCCCCAGGAGGTGTTCCTGCTGGTCGGCCCCAGTGGTGTGGGAAAA
ACCGAAACGGCACTGGCGCTGGCAGATGTGATGTACGGCGGCGAAAAATCACTGATTACCATCAATCTGT
CGGAATATCAGGAGCCCCATACGGTTTCCCAGCTTAAGGGTTCACCGCCCGGGTACGTGGGATACGGTCA
GGGGGGTATTCTGACGGAAGCTGTACGTAAGCGCCCTTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAG
GCCCACCGGGATGTGCTGAATCTGTTCTACCAGGTGTTTGACCGGGGCTTTATGCGCGACGGTGAGGGGC
GTGAAATTGACTTCCGTAATACGGTCATTCTGATGACCTCCAATCTGGGCAGTGACCTTCTGATGCAGCA
ACTGAGCGAAAAGCCGGAGACAACGGAATCGGAGCTGCATGAGCTTATCCGTCCACTGCTGCGCGACCAC
TTCCAGCCAGCACTGCTTGCCCGTTTCCAGACCGTGATTTACCGTCCGCTGACACCGTCTGCTATGCGCA
CCATTGTGGAGATGAAGCTTGCACAGGTCTGCGAACGCCTGCACTGCCATTATGGGCTGAGCACATCGGT
TGATGAACGTGTGTACGATGCCCTGACATCCGCCTGCCTGCTGCCGGATACGGGCGCCCGGAATGTGGAG
AGTCTGCTGAACCAGCAACTGCTGCCGGTACTGAGCCGGCAGTTGCTGAGCCATATGGCCGCGAAGCAGA
AACCGCAGGCGCTGGCTCTGGCATGGAGTGACGAAGACGGTATGGTGATTGAGCTGCGGCAGGAATGCGC
GTTATGA