SecReT6
Protein ID: 218696636
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3337
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3425070..3425789 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7LG69
KEGG IDeck:EC55989_3337
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.30E-41, Aligned region: 34..228
Protein Sequence: 239 a.a.     [Download]
>gi|218696636|ref|YP_002404303.1| hypothetical protein EC55989_3337 [Escherichia coli 55989]
MYFLHPGIAGRCETGTFCGAADMNKPVISRAEQIFYPGWLMVSQLRSGQPVEDGKALYRRACQLVKQARE
ELAEAGFSQKSSDIMLYAFCALLDESVLNREKTDDGWRTWQQDPLQAHFFGTLNAGEELWERIREQLKLP
APDVAVLTCLCRTLQLGFTGQYRSQDDERREDVIRALTARVPAFTFAQDAPVVVRAPGYRAGRTMYWLSW
GAGIVTLAGLWCVLSSVLADQVARLTGQG
 
Nucleotide Sequence: 720 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3425789-3425070 Escherichia coli 55989 chromosome, complete genome
TTGTACTTTCTACACCCCGGCATCGCTGGGAGATGTGAAACTGGAACTTTTTGCGGTGCTGCGGACATGA
ATAAACCTGTTATCTCCCGGGCTGAACAGATTTTTTATCCCGGCTGGCTGATGGTCAGCCAGCTGCGCAG
CGGGCAACCGGTTGAGGATGGTAAGGCCCTGTATCGCCGTGCCTGTCAGCTGGTGAAACAGGCGCGTGAA
GAGCTGGCCGAAGCAGGATTCAGTCAGAAAAGCAGTGACATCATGTTGTATGCCTTCTGCGCCCTGCTGG
ACGAGAGTGTACTGAACCGCGAAAAAACAGACGATGGCTGGCGCACCTGGCAGCAGGACCCGCTGCAGGC
TCATTTTTTTGGTACGCTCAATGCCGGTGAAGAGCTCTGGGAGCGTATTCGTGAACAACTGAAATTACCA
GCGCCGGATGTGGCGGTACTGACATGCCTCTGCCGTACGCTTCAGCTCGGTTTTACCGGTCAGTACCGGT
CGCAGGATGATGAGCGTCGCGAAGATGTAATACGCGCACTGACAGCGCGTGTTCCTGCATTTACTTTCGC
ACAGGATGCGCCGGTGGTGGTGCGTGCACCGGGTTACCGTGCTGGCAGAACGATGTACTGGTTGTCATGG
GGGGCGGGTATTGTGACGCTGGCTGGTCTCTGGTGTGTGCTTTCTTCTGTGCTTGCAGACCAGGTGGCAC
GGCTTACCGGGCAGGGATAA