SecReT6
Protein ID: 218696637
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3338
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3425720..3427057 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7LG64
KEGG IDeck:EC55989_3338
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.60E-125, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|218696637|ref|YP_002404304.1| hypothetical protein EC55989_3338 [Escherichia coli 55989]
MKIYRPLWEDGAFLMPQQFQQQAAWDVHLADSVARMGLAHPWGVVAAEFDDSLLPLSRLNATRLIVRFPD
GTLIDTERADNLPPVCDLSTVSDRSLVDIVLALPLLNANGGNLDNGSESERPRRWKSERVNVQELAGHEQ
SEVAVLRHNLTLRMAHQENAAWLTCPVTRLVRDAQGQWCRDPRFIPPLLTLSAGPSLMTELAELLHHLQA
RRQRLMSMRRENNARLADFAVADVSLFWLLNALNSAEPVLKELLDMPYRHPELLYRELARLAGSLLTFSL
EHNVDAVPAYHHETPENVFPPLLSLLNRLLEASLPSRVVFIELKQKGVMWEGALHDARLREGADFWLSVR
SSMPGHELQTKFPQLCKAGSPDDVSEVVNVALSGVIIRPVTHVPAAIPLRLENQYFALDLSTDAARAMLD
AGRCTFYTPASLGDVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3427057-3425720 Escherichia coli 55989 chromosome, complete genome
ATGAAGATTTATCGCCCACTATGGGAAGACGGGGCTTTTCTGATGCCCCAGCAGTTTCAGCAGCAGGCTG
CCTGGGATGTTCATCTGGCAGACAGCGTTGCCAGAATGGGGCTGGCGCATCCATGGGGCGTGGTGGCTGC
AGAGTTTGATGACTCTCTGTTACCGCTTTCACGGTTGAATGCCACCCGTCTGATTGTTCGTTTCCCGGAC
GGAACGCTTATTGATACGGAACGCGCGGATAATCTGCCTCCGGTCTGTGATTTATCGACGGTTTCTGATC
GTTCCCTGGTGGATATTGTGCTGGCACTACCGTTACTGAATGCTAACGGTGGCAACCTTGATAATGGCAG
TGAGAGCGAGCGTCCGCGTCGCTGGAAATCAGAAAGGGTGAATGTGCAGGAGCTGGCCGGGCATGAGCAA
AGCGAAGTGGCGGTATTGCGGCATAACCTGACTCTGCGCATGGCTCATCAGGAAAATGCTGCCTGGCTGA
CCTGTCCCGTTACCCGTCTTGTTCGTGATGCACAGGGACAGTGGTGCAGGGACCCGCGTTTTATTCCCCC
TCTGCTGACGCTGTCTGCCGGTCCTTCGCTGATGACTGAACTTGCGGAGTTGCTTCATCACCTGCAGGCG
CGTCGCCAGCGACTGATGTCCATGCGTCGGGAGAACAATGCCCGTCTTGCGGATTTTGCTGTGGCGGACG
TGTCGTTGTTCTGGTTGCTGAATGCCCTGAACAGTGCGGAGCCTGTTCTGAAAGAGTTGCTTGACATGCC
TTACCGCCACCCGGAACTGTTGTACAGGGAGCTTGCCCGGCTGGCAGGCTCCCTGCTCACATTCTCGCTT
GAGCATAATGTGGATGCGGTTCCGGCATACCATCATGAAACACCTGAAAATGTTTTCCCACCATTGCTTT
CTTTGCTGAATCGGCTGCTGGAGGCAAGCCTGCCTTCCCGTGTGGTTTTCATTGAACTGAAACAAAAGGG
TGTGATGTGGGAGGGGGCATTACATGATGCGCGTCTGCGCGAAGGGGCTGATTTCTGGCTTTCAGTGCGC
TCTTCCATGCCCGGGCATGAACTGCAGACGAAGTTTCCGCAGCTATGCAAAGCCGGGAGCCCCGATGATG
TGTCTGAGGTGGTGAATGTGGCGCTGAGCGGGGTCATTATCCGTCCGGTTACGCATGTACCGGCGGCCAT
TCCGCTCCGGCTGGAAAACCAGTATTTCGCGCTGGATTTAAGTACGGATGCGGCCCGGGCGATGCTGGAC
GCGGGGCGTTGTACTTTCTACACCCCGGCATCGCTGGGAGATGTGAAACTGGAACTTTTTGCGGTGCTGC
GGACATGA