SecReT6
Protein ID: 218696638
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3339
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3427073..3428617 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7LG71
KEGG IDeck:EC55989_3339
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-174, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|218696638|ref|YP_002404305.1| hypothetical protein EC55989_3339 [Escherichia coli 55989]
MLMSVQKEKNVAESVVSEAHAGDSVYASLFEKINLSPVSALSALDIWQDPQAMSEASADERLTAGMQVFM
ECLAKAGTQVEKLDKALIDHHIAELDYQISRQLDAVLHHPEFQKVESLWRGVKSLVDKTDFRRNVKIELL
DLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALVSAWEFDASAQDVALLKNISRVAASAHM
PFIGSVGPAFFQKETMEEVAAIKDIGNHFERAEYIKWNAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHHKYLWTNASFAFAANMVRSFVTNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRLLELELNNWIRGLVTEMTDPGDELQASHPLRDGKVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVSLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3428617-3427073 Escherichia coli 55989 chromosome, complete genome
ATGCTGATGTCTGTACAGAAAGAAAAGAACGTTGCAGAGAGCGTGGTATCTGAAGCGCATGCCGGCGACA
GCGTATATGCTTCCCTGTTTGAAAAAATTAACCTGAGTCCGGTATCTGCCCTGAGTGCACTGGATATCTG
GCAGGATCCACAGGCCATGTCAGAAGCATCTGCAGATGAACGTCTGACGGCAGGGATGCAGGTGTTTATG
GAGTGTCTGGCAAAAGCCGGCACGCAGGTGGAAAAACTCGATAAAGCGCTGATTGACCATCATATTGCAG
AGCTTGATTATCAGATCAGCCGTCAACTGGATGCTGTGCTTCATCATCCGGAATTTCAGAAAGTGGAGTC
GCTGTGGCGGGGCGTGAAGTCCCTGGTGGATAAAACGGACTTCCGCCGTAATGTGAAAATTGAGCTGCTG
GATCTGTCCAAAGACGATCTGCGTCAGGATTTTGAGGATGCGCCGGAAATTATTCAGAGCGGCCTTTATC
TGCAGACCTATGTGGCTGAGTATGACACGCCGGGTGGTGAGCCCATTGCCGCCCTGGTTTCAGCCTGGGA
GTTTGATGCATCTGCACAGGACGTGGCGTTGCTGAAAAATATTTCCCGGGTGGCGGCATCTGCACATATG
CCGTTTATTGGTTCAGTTGGCCCGGCGTTCTTCCAGAAAGAAACCATGGAAGAGGTGGCTGCCATCAAGG
ATATTGGCAACCACTTTGAGCGTGCCGAGTACATCAAGTGGAATGCTTTCCGTGAGACGGACGATGCCCG
CTATATTGGCCTGGTGATGCCCCGTGTACTGGGACGCCTGCCGTATGGCCCGGATACCGTACCTGTCCGC
AGCTTTAACTATGTTGAAGAGGTGAAAGGACCGGACCACCATAAATATCTCTGGACGAACGCGTCTTTTG
CCTTTGCAGCCAACATGGTGCGCAGTTTTGTCACCAACGGCTGGTGTGTTCAGATCCGTGGGCCTCAGGC
CGGTGGTGCGGTGCAGGATTTGCCAATCCATTTGTATGATCTGGGAACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACGCGGGAGTTTGAATTCGCGAATCTGGGCTTTATTCCGCTCTCTTACT
ACAAGAACCGGGATTATGCCTGCTTCTTCTCTGCTAACTCCGCCCAGAAACCGGCGCTGTACGATACGCC
GGATGCAACGGCGAACAGTCGTATTAATGCCCGTCTTCCCTATATCTTCCTGCTGTCCCGTATTGCGCAT
TACCTGAAGATCATTCAGCGGGAAAATATCGGTACCACCAAAGATCGCCGTCTGCTTGAGCTGGAGCTGA
ATAACTGGATCCGGGGACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCCTCGCATCCGCT
GCGTGACGGAAAAGTGGTGGTGGAAGATATCGAAGACAATCCGGGATTCTTCCGCGTGAAACTCTACGCC
GTACCGCATTTCCAGGTAGAAGGTATGGACGTCAGCCTGTCACTGGTTTCGCAGATGCCGAAGGCAAAAG
CGTAA