SecReT6
Protein ID: 218696639
SecReT6 ID486
T6SS typei2
Gene symbol-
Locus tagEC55989_3340
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3428639..3429160 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7LG72
KEGG IDeck:EC55989_3340
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.70E-52, Aligned region: 14..166
Protein Sequence: 173 a.a.     [Download]
>gi|218696639|ref|YP_002404306.1| hypothetical protein EC55989_3340 [Escherichia coli 55989]
MQVSQERAMSSSFQNEIPKARVNLKLDLHTGGGQKKVELPLKLLVAGDFSNGQEERPLSERVKTDINKNN
FNDVLADISPSVHLNVENTLAGDGSEESISLTFRNMNDFTPEQVARQIPRLKAMLAMRSLLRDLKANLLD
NVTFRKELEKILRDPALSQTLRDELRALVPEKA
 
Nucleotide Sequence: 522 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3429160-3428639 Escherichia coli 55989 chromosome, complete genome
ATGCAGGTTTCACAGGAGAGAGCCATGAGCAGTTCGTTTCAGAATGAAATCCCGAAAGCAAGGGTAAATC
TGAAATTAGACCTACATACGGGTGGTGGGCAGAAGAAAGTGGAGCTTCCGCTCAAACTTCTGGTTGCCGG
TGATTTCAGTAACGGACAGGAAGAGCGTCCACTGTCAGAGCGTGTAAAAACGGATATTAATAAAAACAAT
TTTAATGATGTTCTGGCAGATATCTCCCCGTCTGTACATCTGAATGTGGAGAACACGCTTGCCGGTGATG
GCTCTGAAGAGAGCATCAGCCTGACTTTCCGCAATATGAACGATTTCACGCCAGAGCAGGTCGCCCGACA
GATTCCCCGTCTTAAAGCCATGCTGGCCATGCGTAGCCTTCTGCGGGACCTGAAAGCCAATCTGCTGGAT
AACGTGACTTTCCGTAAAGAGCTGGAAAAAATTCTGCGTGACCCGGCACTGAGTCAGACGCTGCGTGATG
AACTGCGTGCACTGGTGCCGGAAAAGGCGTGA