SecReT6
Protein ID: 218703466
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0214
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]241530..242009 [-]
Producthypothetical protein
NoteTssD
UniProt IDB7N879
KEGG IDeum:ECUMN_0214
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-33, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|218703466|ref|YP_002410985.1| hypothetical protein ECUMN_0214 [Escherichia coli UMN026]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVMSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLTNARISNIGLTVPHTINDSPGQPEESVSFTYESIN
WEHIVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_011751.1|:c242009-241530 hypothetical protein ECUMN_0214 [Escherichia coli UMN026]
ATGGCAAATCCCGTCTATCTGACACTAAACGGAGAACTCCAGGGACTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAGGCCCAGATTGCACATCAGGATCAGATCATGGTGATGTCACTGTCCCATGG
GCTGAGTCGCGCACAGAACGTCAATCACCAGGAACTGACTATCACGAAACCGGTGGACAAATCCTCCCCC
CTTCTGGGCAAGGCCATTTCGGAGAATGAATGTCTGACCTGTGATTTTGTCTTCTATCGCACCAACCGTT
TTGGTATTAATGAGCCGTACTACAAGCTGAAACTGACTAATGCCCGGATCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGCCCAGGGCAGCCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAC
TGGGAGCACATCGTCGCCGGAACCAGTGCGTACAGTCTGTGGAGTGAACGGATTTTCTAA