SecReT6
Protein ID: 218703466
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0214
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]241530..242009 [-]
Producthypothetical protein
NoteTssD
UniProt IDB7N879
KEGG IDeum:ECUMN_0214
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.80E-33, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|218703466|ref|YP_002410985.1| hypothetical protein ECUMN_0214 [Escherichia coli UMN026]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVMSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLTNARISNIGLTVPHTINDSPGQPEESVSFTYESIN
WEHIVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_011751.1|:c242009-241530 hypothetical protein ECUMN_0214 [Escherichia coli UMN026]
ATGGCAAATCCCGTCTATCTGACACTAAACGGAGAACTCCAGGGACTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAGGCCCAGATTGCACATCAGGATCAGATCATGGTGATGTCACTGTCCCATGG
GCTGAGTCGCGCACAGAACGTCAATCACCAGGAACTGACTATCACGAAACCGGTGGACAAATCCTCCCCC
CTTCTGGGCAAGGCCATTTCGGAGAATGAATGTCTGACCTGTGATTTTGTCTTCTATCGCACCAACCGTT
TTGGTATTAATGAGCCGTACTACAAGCTGAAACTGACTAATGCCCGGATCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGCCCAGGGCAGCCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAC
TGGGAGCACATCGTCGCCGGAACCAGTGCGTACAGTCTGTGGAGTGAACGGATTTTCTAA

Protein ID: 218703481
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0229
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]261820..262338 [+]
Producthypothetical protein
NoteTssD
UniProt IDB7N894
KEGG IDeum:ECUMN_0229
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0034, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|218703481|ref|YP_002411000.1| hypothetical protein ECUMN_0229 [Escherichia coli UMN026]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_011751.1|:261820-262338 hypothetical protein ECUMN_0229 [Escherichia coli UMN026]
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCACAGTCTGGTCAACCTTCCGGGCAGCGCGCGCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACTTCAGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCACATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCATACCGTAAGGTTGAGTGGGAGCACATCAAATCCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA