SecReT6
Protein ID: 218703467
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0215
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]242027..243526 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7N880
KEGG IDeum:ECUMN_0215
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 4.60E-45, Aligned region: 140..203
DUF3702 [PF12486], Evalue: 4.60E-45, Aligned region: 305..318
DUF3702 [PF12486], Evalue: 4.60E-45, Aligned region: 335..481
ImpA-rel_N [PF06812], Evalue: 6.80E-21, Aligned region: 88..147
Protein Sequence: 499 a.a.     [Download]
>gi|218703467|ref|YP_002410986.1| hypothetical protein ECUMN_0215 [Escherichia coli UMN026]
MTPLTCALTWTAAQWFTGCMWIPKITRSPAVCSACSVYRIRCIKGIVMSNYALTQTIVTGSDPRALPEFS
AIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGSELLAAMITHE
WDKFWPQGGPARTEMLDWFNTRTGNILRQQVSFSENDLPLLYRTERALQLICDKLQQVELKRQPRVENLL
YFVQNTRKRFEPQPGNRTDTAAQTTVRTLVYAPESTASTTAEAVPPLPDLPEMRVEVRGVANNADNVRQG
STVKGFVAGAACTAVIAAVLWWWQAYPIQRQLTQVRDTAQGAATAWLASPVLKEYEQYLQQLLDAPPLQP
LETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFADLMMKKETEKQGFT
LSYIKTVTWQAERLLNQETPLEYLLTQYQETRARKQDTQALEKEINERLDGLLSRWLLLKNTGQDMATDT
RTEPVHPTH
 
Nucleotide Sequence: 1500 bp     [Download]
>ref|NC_011751.1|:c243526-242027 hypothetical protein ECUMN_0215 [Escherichia coli UMN026]
GTGACACCTTTAACGTGCGCTTTAACGTGGACGGCGGCGCAATGGTTTACCGGGTGCATGTGGATACCGA
AGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAAGGGGATAGT
GATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGC
GCCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAAT
CGCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCGCG
TACCCGTAATCAGGGGCTGGCAGGGTTCTGCGAAGGCTCGGAACTGCTGGCTGCGATGATCACCCACGAA
TGGGATAAATTCTGGCCGCAGGGTGGCCCGGCGCGGACTGAGATGCTGGACTGGTTCAATACCCGCACCG
GGAATATTCTGCGCCAGCAGGTGTCCTTTTCCGAAAATGATCTGCCGTTGCTCTACCGCACGGAACGGGC
TTTACAGCTTATTTGCGACAAACTCCAGCAGGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAACCTGCTT
TATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCGGAAACCGTACTGATACGGCGGCACAGA
CCACGGTCCGGACGCTGGTCTATGCGCCGGAAAGCACGGCTTCCACCACAGCGGAAGCCGTGCCTCCCCT
GCCCGACCTGCCGGAAATGCGGGTGGAGGTGCGCGGTGTGGCAAATAACGCCGACAACGTTAGACAGGGC
AGCACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCGGCAGTACTCTGGTGGTGGC
AGGCGTATCCGATACAACGGCAGCTTACGCAAGTCAGGGATACCGCACAGGGAGCCGCCACCGCCTGGTT
GGCCTCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGGATGCCCCGCCACTACAGCCG
CTGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAG
CCAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACA
GGCGCGGCAGAATTTGCGGGACTTTGCGGATCTGATGATGAAAAAGGAGACGGAGAAACAGGGTTTCACC
CTCTCGTATATCAAGACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAGGAAACACCGCTGGAGTACC
TGCTGACACAGTACCAGGAGACACGCGCACGGAAGCAGGACACACAGGCGCTGGAAAAAGAGATCAACGA
ACGGCTGGACGGGCTGTTAAGCCGCTGGCTACTGCTGAAAAATACCGGACAGGATATGGCAACGGATACC
AGAACCGAACCTGTCCATCCGACTCATTGA