SecReT6
Protein ID: 218703472
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0220
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]251872..252645 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7N885
KEGG IDeum:ECUMN_0220
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-62, Aligned region: 36..240
Protein Sequence: 257 a.a.     [Download]
>gi|218703472|ref|YP_002410991.1| hypothetical protein ECUMN_0220 [Escherichia coli UMN026]
MSDISDMGEPSVFPMEPESGTSGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFAQVVT
DVQAVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLER
LIREPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGR
YQLIRRLTIRHVLCGGLVVLAVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 774 bp     [Download]
>ref|NC_011751.1|:c252645-251872 hypothetical protein ECUMN_0220 [Escherichia coli UMN026]
ATGAGCGATATCAGCGATATGGGTGAACCGTCGGTTTTTCCCATGGAGCCGGAGAGCGGAACATCAGGAC
GTCAGTACCGTCTCGCCCTTCGCGGCAACAGCCTGAACCCAATGATTGACGCCGCCACGCCGTTGCTCGG
CATGGTGATGCGTCTGTCCACCATGAACAGCCAGGCCATGCCGGAACATCTGTTTGCCCAGGTGGTAACC
GATGTCCAGGCTGTGGAACAACTACTCCAGGAGCAGGGTTACGAGCCGGGCGTCATTGTTTCGTTCCGCT
ACATTCTCTGCACGTTTATTGACGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATAAA
ACAGTCGCTACTGGTTCATTTCCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGC
CTGATCCGGGAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGCTTTTCGCTGGGCTTTC
GCGGGCGCTACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGC
CCTGCACAAACTGCGCGGTGACGCGCCATTTCCGCTGCTTCACCAGAAGAACAACATACAGGGCGGGCGT
TATCAGTTAATCCGGCGGCTGACCATCAGGCATGTACTGTGCGGCGGTCTTGTTGTGCTGGCCGTATTTT
ATCTGTTTTATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCG
ATAA